Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-c5ar1 Antibody scFv

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human c5ar1 Antibody scFv Fragment MOM-18297-S(P) 1mg Please Inquiry
Product Detail
Cat
MOM-18297-S(P)
Product Overview
Recombinant Mouse Antibody scFv Fragment is bind to Human C5AR1, expressed in E. coli
Target
C5AR1
Type
scFv
Immunogen
Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, corresponding to N terminal amino acids 1-31 of Human C5R1MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
Species Reactivity
Human
Expression Host
E. coli
Applications
Suitable for use in ELISA, WB, Neut and most other immunological methods.
Specificity
Tested positive against native antigen.
Purity
>95.0% as determined by analysis by RP-HPLC.
Storage
Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.
Background
Antigen Description
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
Function
C5a anaphylatoxin receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity;
Gene ID
728
Synonyms
C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Loading...
Contact Us

USA
Tel: 1-631-871-5806
Fax: 1-631-207-8356
Email: 

Europe
Tel: 44-207-097-1828


© 2007 - 2017 Creative-Biolabs All Rights Reserved