Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-c5ar1 Antibody

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human c5ar1 Antibody MOM-18297 1mg Please Inquiry
Product Detail
Cat
MOM-18297
Product Overview
Recombinant Mouse Antibody is specific to Human C5AR1, expressed in Chinese Hamster Ovary cells(CHO)
Target
C5AR1
Type
IgG
Immunogen
Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, corresponding to N terminal amino acids 1-31 of Human C5R1MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
Species Reactivity
Human
Expression Host
CHO
Applications
Suitable for use in ELISA, IP, FC, FuncS, IF, Neut and most other immunological methods.
Specificity
Tested positive against native antigen.
Purity
>97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Storage
Store at -20°C for long-term storage. Store at 2-8°C for up to one month. Avoid freeze/thaw cycles.
Background
Antigen Description
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
Function
C5a anaphylatoxin receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity;
Gene ID
728
Synonyms
C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Loading...
Contact Us

USA
Tel: 1-631-871-5806
Fax: 1-631-207-8356
Email: 

Europe
Tel: 44-207-097-1828


© 2007 - 2017 Creative-Biolabs All Rights Reserved