Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-cldn4 Antibody scFv

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cldn4 Antibody scFv Fragment MOM-18330-S(P) 1mg Please Inquiry
Product Detail
Cat
MOM-18330-S(P)
Product Overview
Recombinant Mouse Antibody scFv Fragment is directed against Human CLDN4, expressed in E. coli
Target
CLDN4
Type
scFv
Immunogen
Recombinant fragment: MWRVTAFIGS NIVTSQTIWE GLWMNCVVQS TGQMQCKVYD SLLALPQDLQ , corresponding to amino acids 29-79 of Human Claudin 4MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYD SLLALPQDLQ
Species Reactivity
Human
Expression Host
E. coli
Applications
Suitable for use in ELISA, WB, Neut and most other immunological methods.
Specificity
Tested positive against native antigen.
Purity
>95%, by SDS-PAGE with silver staining, under reducing conditions.
Storage
Store at -20°C for long-term storage. Store at 2-8°C for up to one month. Avoid freeze/thaw cycles.
Background
Antigen Description
Plays a major role in tight junction-specific obliteration of the intercellular space.
Function
identical protein binding; structural molecule activity; transmembrane signaling receptor activity;
Gene ID
1364
Synonyms
CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Loading...
Contact Us

USA
Tel: 1-631-871-5806
Fax: 1-631-207-8356
Email: 

Europe
Tel: 44-207-097-1828


© 2007 - 2017 Creative-Biolabs All Rights Reserved