Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-cldn4 Antibody

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cldn4 Antibody MOM-18330 1mg Please Inquiry
Product Detail
Cat
MOM-18330
Product Overview
Recombinant Mouse Antibody binds selectively to Human CLDN4, expressed in Chinese Hamster Ovary cells(CHO)
Target
CLDN4
Type
IgG
Immunogen
Recombinant fragment: MWRVTAFIGS NIVTSQTIWE GLWMNCVVQS TGQMQCKVYD SLLALPQDLQ , corresponding to amino acids 29-79 of Human Claudin 4MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYD SLLALPQDLQ
Species Reactivity
Human
Expression Host
CHO
Applications
Suitable for use in IF, IP, Neut and most other immunological methods.
Specificity
Tested positive against native antigen.
Purity
>95.0% as determined by analysis by SDS-PAGE.
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.
Background
Antigen Description
Plays a major role in tight junction-specific obliteration of the intercellular space.
Function
identical protein binding; structural molecule activity; transmembrane signaling receptor activity;
Gene ID
1364
Synonyms
CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Loading...
Contact Us

USA
Tel: 1-631-871-5806
Fax: 1-631-207-8356
Email: 

Europe
Tel: 44-207-097-1828


© 2007 - 2017 Creative-Biolabs All Rights Reserved