Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-cyr61 Antibody

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cyr61 Antibody MOM-18303 1mg Please Inquiry
Product Detail
Cat
MOM-18303
Product Overview
Recombinant Mouse Antibody is specific to Human CYR61, expressed in Chinese Hamster Ovary cells(CHO)
Target
CYR61
Type
IgG
Immunogen
Recombinant fragment: IKDPMEDQDG LLGKELGFDA SEVELTRNNE LIAVGKGSSL KRLPVFGMEP RILYNPLQGQ KCIVQTTSWS QCSKT, corresponding to amino acids 168-242 of human CCN1 purified from E. coliIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSL KRLPVFGMEPRILYNPLQGQKCIVQTTSWSQCSKT
Species Reactivity
Human
Expression Host
CHO
Applications
Suitable for use in WB, ELISA, IP, FC, FuncS, Neut and most other immunological methods.
Specificity
Tested positive against native antigen.
Purity
>95.0%, determined by analysis by RP-HPLC & analysis by SDS-PAGE.
Storage
Store the antibody (in aliquots) at -20°C. Avoid repeated freezing and thawing of samples.
Background
Antigen Description
Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
Function
extracellular matrix binding; heparin binding; insulin-like growth factor binding; integrin binding;
Gene ID
3491
Synonyms
CYR61; cysteine-rich, angiogenic inducer, 61; IGFBP10; protein CYR61; CCN1; GIG1; IBP-10; IGFBP-10; CCN family member 1; IGF-binding protein 10; cysteine-rich, anigogenic inducer, 61; cysteine-rich heparin-binding protein 61; insulin-like growth factor-binding protein 10
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Loading...
Contact Us

USA
Tel: 1-631-871-5806
Fax: 1-631-207-8356
Email: 

Europe
Tel: 44-207-048-3343


© 2007 - 2017 Creative-Biolabs All Rights Reserved