Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-ephb2 Antibody scFv

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human ephb2 Antibody scFv Fragment MOM-18352-S(P) 1mg Please Inquiry
Product Detail
Cat
MOM-18352-S(P)
Product Overview
Recombinant Mouse Antibody scFv Fragment is directed against Human EPHB2, expressed in E. coli
Target
EPHB2
Type
scFv
Immunogen
Recombinant His-taggedged fragment corresponding to amino acids 17-200 of Human Eph receptor B2AAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTI RTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRD CSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWV KVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSG
Species Reactivity
Human
Expression Host
E. coli
Applications
Suitable for use in ELISA, WB, Neut and most other immunological methods.
Specificity
Tested positive against native antigen.
Purity
>95%, by SDS-PAGE with silver staining, under reducing conditions.
Storage
4°C. For long term storage, aliquot and store at -20°C. Repeated thawing and freezing must be avoided.
Background
Antigen Description
Receptor for members of the ephrin-B family. Phosphorylates ARHGEF15, leading to its ubiquitination and degradation by the proteasome which promotes EFNB1-dependent synapse formation. Can function in aspects of retinal ganglion cell axon guidance to the optic disk even when lacking its tyrosine kinase domain. Acts as a tumor suppressor.
Function
ATP binding; ephrin receptor activity; nucleotide binding; protein tyrosine kinase activity; receptor activity; transmembrane-ephrin receptor activity; transmembrane-ephrin receptor activity;
Gene ID
2048
Synonyms
EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Loading...
Contact Us

USA
Tel: 1-631-871-5806
Fax: 1-631-207-8356
Email: 

Europe
Tel: 44-207-097-1828


© 2007 - 2017 Creative-Biolabs All Rights Reserved