Follow us on:
Dedication / Services
To provide 50000 services and products to global scientific research units every year

Anti-c5ar1 Antibody Fab

Recombinant Anti-Human c5ar1 Antibody Fab Fragment MOM-18297-F(E) 1mg Please Inquiry
Product Detail
Product Overview
Recombinant Mouse Antibody Fab Fragment is directed against Human C5AR1, expressed in Chinese Hamster Ovary cells(CHO)
Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, corresponding to N terminal amino acids 1-31 of Human C5R1MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
Species Reactivity
Expression Host
Suitable for use in FC, IP, ELISA, Neut, FuncS, IF and most other immunological methods.
Tested positive against native antigen.
>95.0% as determined by Analysis by RP-HPLC & analysis by SDS-PAGE.
Store it under sterile conditions at -20°C upon receiving. Recommend to pack the protein into smaller quantities for optimal storage.
Antigen Description
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
C5a anaphylatoxin receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity;
Gene ID
C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1
Download Datasheet:

Our customer service representatives are available 24 hours a day, from Monday to Sunday. Contact Us

Online Inquiry
Please input "biolabs"(case insensitive) as verification code.
Contact Us

Tel: 1-631-381-2994
Fax: 1-631-207-8356

Tel: 44-207-048-3343

Techhnical Platforms

Phage Display Platform Protein Engineering Platform Membrane Protein Platform Hybridoma Platform
© 2007 - 2018 Creative-Biolabs All Rights Reserved