Close

Anti-c5ar1 Antibody (MOM-18297)

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human c5ar1 Antibody MOM-18297 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody is specific to Human C5AR1, expressed in Chinese Hamster Ovary cells(CHO)
  • Target
  • C5AR1
  • Type
  • IgG
  • Immunogen
  • Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, corresponding to N terminal amino acids 1-31 of Human C5R1MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
  • Species Reactivity
  • Human
  • Expression Host
  • CHO
  • Applications
  • Suitable for use in ELISA, IP, FC, FuncS, IF, Neut and most other immunological methods.
  • Specific Activity
  • Tested positive against native antigen.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Storage
  • Store at -20°C for long-term storage. Store at 2-8°C for up to one month. Avoid freeze/thaw cycles.

BACKGROUND

  • Antigen Description
  • Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
  • Function
  • C5a anaphylatoxin receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity;
  • Synonyms
  • C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1

Related Products

All listed customized services & products are for research use only, not intended for pharmaceutical, diagnostic, therapeutic or any in vivo human use.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

USA: 45-1 Ramsey Road, Shirley, NY 11967, USA
Europe: Heidenkampsweg 58, 20097 Hamburg, Germany
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us