Close

Anti-c5ar1 Antibody (MOM-18297)

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human c5ar1 Antibody MOM-18297 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody is specific to Human C5AR1, expressed in Chinese Hamster Ovary cells(CHO)
  • Target
  • C5AR1
  • Type
  • IgG
  • Immunogen
  • Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, corresponding to N terminal amino acids 1-31 of Human C5R1MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
  • Species Reactivity
  • Human
  • Expression Host
  • CHO
  • Applications
  • Suitable for use in ELISA, IP, FC, FuncS, IF, Neut and most other immunological methods.
  • Specificity
  • Tested positive against native antigen.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Storage
  • Store at -20°C for long-term storage. Store at 2-8°C for up to one month. Avoid freeze/thaw cycles.

BACKGROUND

  • Antigen Description
  • Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
  • Function
  • C5a anaphylatoxin receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity;
  • Synonyms
  • C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1

Related Products

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us