Close

Anti-cldn4 Antibody scFv (MOM-18330-S(P))

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cldn4 Antibody scFv Fragment MOM-18330-S(P) 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody scFv Fragment is directed against Human CLDN4, expressed in E. coli
  • Target
  • CLDN4
  • Type
  • scFv
  • Immunogen
  • Recombinant fragment: MWRVTAFIGS NIVTSQTIWE GLWMNCVVQS TGQMQCKVYD SLLALPQDLQ , corresponding to amino acids 29-79 of Human Claudin 4MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYD SLLALPQDLQ
  • Species Reactivity
  • Human
  • Expression Host
  • E. coli
  • Applications
  • Suitable for use in ELISA, WB, Neut and most other immunological methods.
  • Specificity
  • Tested positive against native antigen.
  • Purity
  • >95%, by SDS-PAGE with silver staining, under reducing conditions.
  • Storage
  • Store at -20°C for long-term storage. Store at 2-8°C for up to one month. Avoid freeze/thaw cycles.

BACKGROUND

  • Antigen Description
  • Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Function
  • identical protein binding; structural molecule activity; transmembrane signaling receptor activity;
  • Synonyms
  • CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R

Related Products

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us