Close

Anti-cldn4 Antibody scFv (MOM-18330-S(P))

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cldn4 Antibody scFv Fragment MOM-18330-S(P) 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody scFv Fragment is directed against Human CLDN4, expressed in E. coli
  • Target
  • CLDN4
  • Type
  • scFv
  • Immunogen
  • Recombinant fragment: MWRVTAFIGS NIVTSQTIWE GLWMNCVVQS TGQMQCKVYD SLLALPQDLQ , corresponding to amino acids 29-79 of Human Claudin 4MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYD SLLALPQDLQ
  • Species Reactivity
  • Human
  • Expression Host
  • E. coli
  • Applications
  • Suitable for use in ELISA, WB, Neut and most other immunological methods.
  • Specific Activity
  • Tested positive against native antigen.
  • Purity
  • >95%, by SDS-PAGE with silver staining, under reducing conditions.
  • Storage
  • Store at -20°C for long-term storage. Store at 2-8°C for up to one month. Avoid freeze/thaw cycles.

BACKGROUND

  • Antigen Description
  • Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Function
  • identical protein binding; structural molecule activity; transmembrane signaling receptor activity;
  • Synonyms
  • CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R

Related Products

All listed customized services & products are for research use only, not intended for pharmaceutical, diagnostic, therapeutic or any in vivo human use.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

USA: 45-1 Ramsey Road, Shirley, NY 11967, USA
Europe: Heidenkampsweg 58, 20097 Hamburg, Germany
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us