Close

Anti-cyr61 Antibody scFv (MOM-18303-S(P))

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cyr61 Antibody scFv Fragment MOM-18303-S(P) 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody scFv Fragment is bind to Human CYR61, expressed in E. coli
  • Target
  • CYR61
  • Type
  • scFv
  • Immunogen
  • Recombinant fragment: IKDPMEDQDG LLGKELGFDA SEVELTRNNE LIAVGKGSSL KRLPVFGMEP RILYNPLQGQ KCIVQTTSWS QCSKT, corresponding to amino acids 168-242 of human CCN1 purified from E. coliIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSL KRLPVFGMEPRILYNPLQGQKCIVQTTSWSQCSKT
  • Species Reactivity
  • Human
  • Expression Host
  • E. coli
  • Applications
  • Suitable for use in ELISA, WB, Neut and most other immunological methods.
  • Specific Activity
  • Tested positive against native antigen.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Storage
  • At -20°C for one year.

BACKGROUND

  • Antigen Description
  • Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
  • Function
  • extracellular matrix binding; heparin binding; insulin-like growth factor binding; integrin binding;
  • Synonyms
  • CYR61; cysteine-rich, angiogenic inducer, 61; IGFBP10; protein CYR61; CCN1; GIG1; IBP-10; IGFBP-10; CCN family member 1; IGF-binding protein 10; cysteine-rich, anigogenic inducer, 61; cysteine-rich heparin-binding protein 61; insulin-like growth factor-binding protein 10

Related Products

All listed customized services & products are for research use only, not intended for pharmaceutical, diagnostic, therapeutic or any in vivo human use.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

USA: 45-1 Ramsey Road, Shirley, NY 11967, USA
Europe: Heidenkampsweg 58, 20097 Hamburg, Germany
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us