Close

Anti-cyr61 Antibody scFv (MOM-18303-S(P))

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human cyr61 Antibody scFv Fragment MOM-18303-S(P) 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody scFv Fragment is bind to Human CYR61, expressed in E. coli
  • Target
  • CYR61
  • Type
  • scFv
  • Immunogen
  • Recombinant fragment: IKDPMEDQDG LLGKELGFDA SEVELTRNNE LIAVGKGSSL KRLPVFGMEP RILYNPLQGQ KCIVQTTSWS QCSKT, corresponding to amino acids 168-242 of human CCN1 purified from E. coliIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSL KRLPVFGMEPRILYNPLQGQKCIVQTTSWSQCSKT
  • Species Reactivity
  • Human
  • Expression Host
  • E. coli
  • Applications
  • Suitable for use in ELISA, WB, Neut and most other immunological methods.
  • Specificity
  • Tested positive against native antigen.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Storage
  • At -20°C for one year.

BACKGROUND

  • Antigen Description
  • Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
  • Function
  • extracellular matrix binding; heparin binding; insulin-like growth factor binding; integrin binding;
  • Synonyms
  • CYR61; cysteine-rich, angiogenic inducer, 61; IGFBP10; protein CYR61; CCN1; GIG1; IBP-10; IGFBP-10; CCN family member 1; IGF-binding protein 10; cysteine-rich, anigogenic inducer, 61; cysteine-rich heparin-binding protein 61; insulin-like growth factor-binding protein 10

Related Products

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us