Close

Anti-ephb2 Antibody scFv (MOM-18352-S(P))

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human ephb2 Antibody scFv Fragment MOM-18352-S(P) 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody scFv Fragment is directed against Human EPHB2, expressed in E. coli
  • Target
  • EPHB2
  • Type
  • scFv
  • Immunogen
  • Recombinant His-taggedged fragment corresponding to amino acids 17-200 of Human Eph receptor B2AAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTI RTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRD CSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWV KVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSG
  • Species Reactivity
  • Human
  • Expression Host
  • E. coli
  • Applications
  • Suitable for use in ELISA, WB, Neut and most other immunological methods.
  • Specific Activity
  • Tested positive against native antigen.
  • Purity
  • >95%, by SDS-PAGE with silver staining, under reducing conditions.
  • Storage
  • 4°C. For long term storage, aliquot and store at -20°C. Repeated thawing and freezing must be avoided.

BACKGROUND

  • Antigen Description
  • Receptor for members of the ephrin-B family. Phosphorylates ARHGEF15, leading to its ubiquitination and degradation by the proteasome which promotes EFNB1-dependent synapse formation. Can function in aspects of retinal ganglion cell axon guidance to the optic disk even when lacking its tyrosine kinase domain. Acts as a tumor suppressor.
  • Function
  • ATP binding; ephrin receptor activity; nucleotide binding; protein tyrosine kinase activity; receptor activity; transmembrane-ephrin receptor activity; transmembrane-ephrin receptor activity;
  • Synonyms
  • EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492

Related Products

All listed customized services & products are for research use only, not intended for pharmaceutical, diagnostic, therapeutic or any in vivo human use.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

USA: 45-1 Ramsey Road, Shirley, NY 11967, USA
Europe: Heidenkampsweg 58, 20097 Hamburg, Germany
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us