Close

Anti-ephb2 Antibody (MOM-18352)

DESCRIPTION CATALOG # SIZE PRICE
Recombinant Anti-Human ephb2 Antibody MOM-18352 1mg Please Inquiry

PRODUCT INFORMATION

  • Product Overview
  • Recombinant Mouse Antibody binds selectively to Human EPHB2, expressed in Chinese Hamster Ovary cells(CHO)
  • Target
  • EPHB2
  • Type
  • IgG
  • Immunogen
  • Recombinant His-taggedged fragment corresponding to amino acids 17-200 of Human Eph receptor B2AAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTI RTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRD CSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWV KVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSG
  • Species Reactivity
  • Human
  • Expression Host
  • CHO
  • Applications
  • Suitable for use in WB, FuncS, IF, Neut and most other immunological methods.
  • Specificity
  • Tested positive against native antigen.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Storage
  • Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

BACKGROUND

  • Antigen Description
  • Receptor for members of the ephrin-B family. Phosphorylates ARHGEF15, leading to its ubiquitination and degradation by the proteasome which promotes EFNB1-dependent synapse formation. Can function in aspects of retinal ganglion cell axon guidance to the optic disk even when lacking its tyrosine kinase domain. Acts as a tumor suppressor.
  • Function
  • ATP binding; ephrin receptor activity; nucleotide binding; protein tyrosine kinase activity; receptor activity; transmembrane-ephrin receptor activity; transmembrane-ephrin receptor activity;
  • Synonyms
  • EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492

Related Products

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us