Close

ACKR1 Membrane Protein Introduction

Introduction of ACKR1

Atypical chemokine receptor 1 (ACKR1) is a new standardized name for the Duffy Antigen Receptor for Chemokines (DARC), and it can bind specifically to many pro-inflammatory chemokines. As a member of the 7-transmembrane (7 TM) domain protein superfamily, ACKR1 is unexpectedly unable to signal through heterotrimeric G proteins. ACKR1 is mainly expressed in erythrocytes, endothelial cells of post-capillary venules, and in cerebellar Purkinje cells, but it cannot be expressed in leukocytes. In erythrocytes, ACKR1 is helpful to shape and buffer chemokine concentration gradients during inflammatory responses by scavenging chemokines. On endothelial cells, ACKR1 is thought to mediate transcytosis of chemokines for subsequent presentation to blood leukocytes.

Basic Information of ACKR1
Protein Name Atypical chemokine receptor 1
Gene Name ACKR1, DARC, FY, GPD
Aliases Duffy antigen/chemokine receptor, Fy glycoprotein (GpFy), Glycoprotein D, Plasmodium vivax receptor, CD_antigen: CD234
Organism Homo sapiens (Human)
UniProt ID Q16570
Transmembrane Times 7
Length (aa) 336
Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Function of ACKR1 Membrane Protein

ACKR1 is an atypical chemokine receptor that binds promiscuously to various inflammatory CC and CXC chemokines, including CCL2, CCL5, CCL17, CXCL1, CXCL5, and CXCL8, without signaling through G proteins. Acting through typical G protein-coupled chemokine receptors, ACKR1 ligands can induce the activation and migration of many leucocyte subsets, including monocytes, T cells, and neutrophils into the vessel wall, and play a pathogenic role during atherosclerosis development. ACKR1 may mediate transcytosis and scavenging the inflammatory chemokines. As a regulator of inflammation, ACKR1 has been examined in various contexts, including sepsis, malaria infection, HIV, cancer, and renal failure; however, a role in chronic inflammatory pathologies has not yet been defined. It has been suggested that ACKR1 may have diagnostic and therapeutic implications in cardiovascular diseases since ACKR1 is expressed by erythrocytes, which are present within atherosclerotic plaques and may promote plaque growth and instability.

Role of chemokines and chemokine receptors in the bone marrow hematopoietic niche. ACKR1 expressed by NECs binds an unknown receptor on HSCs and regulates hematopoiesis, in particular, myeloid differentiation. Fig.1 Role of chemokines and chemokine receptors in the bone marrow hematopoietic niche. ACKR1 expressed by NECs binds an unknown receptor on HSCs and regulates hematopoiesis, in particular, myeloid differentiation. (Locati, 2017)

Application of ACKR1 Membrane Protein in Literature

  1. Horuk R. The Duffy Antigen Receptor for Chemokines DARC/ACKR1. Frontiers in Immunology. 2015, 6: 279. PubMed ID: 26097477

    This article finds that the parallels to the CCR5 delta32 mutation as a protective factor in infection by HIV and the successful development of a CCR5 inhibitor to treat AIDS are striking and we envisage that the development of a DARC inhibitor might also work for P. vivax-induced malaria.

  2. Rappoport N., et al. Correlation between 'ACKR1/DARC null' polymorphism and benign neutropenia in Yemenite Jews. Br J Haematol. 2015, 170(6): 892-5. PubMed ID: 25817587

    This article suggests the strong and statistically significant correlation between C/C homozygosity of a specific SNP (rs2814778) and the clinical manifestation of benign neutropenia in Yemenite Jew.

  3. Wan W., et al. Atypical chemokine receptor 1 deficiency reduces atherogenesis in ApoE-knockout mice. Cardiovasc Res. 2015, 106(3): 478-87. PubMed ID: 25858253

    This article suggests that Ackr1 plays a critical role in chronic inflammation, in particular in the ApoE-/- mouse model of atherogenesis. The mechanism may involve control of cytokine and chemokine balance in blood and plaque, including regulation of the important T cell and macrophage-targeted chemokine Ccl2. Ackr1 may be considered as a potential target for therapeutic development in atherosclerosis.

  4. Schneider E.H., et al. Regulation of motor function and behavior by atypical chemokine receptor 1. Behavior genetics. 2014, 44(5): 498-515. PubMed ID: 24997773

    This article reveals that Ackr1 plays an important role in regulating the central nervous system at the level of motor function and behavior.

  5. Davis M.B., et al. Distinct Transcript Isoforms of the Atypical Chemokine Receptor 1 (ACKR1)/Duffy Antigen Receptor for Chemokines (DARC) Gene Are Expressed in Lymphoblasts and Altered Isoform Levels Are Associated with Genetic Ancestry and the Duffy-Null Allele. PLoS One. 2015, 10(10): e0140098. PubMed ID: 26473357

    This article suggests that people of African ancestry have distinct relative levels of DARC isoforms. The expression of both isoforms in combination with alternate alleles yields multiple Duffy antigens in ancestry groups, depending upon the haplotypes across the gene.

ACKR1 Preparation Options

Membrane protein studies have advanced significantly over the past few years. Based on our versatile MemDX™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-ACKR1 antibody development services.


During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are happy to accelerate the development of our clients’ programs with one-stop, custom-oriented service. For more detailed information, please feel free to contact us.

Reference

  1. Locati M, et al. (2017). Atypical matters in myeloid differentiation. Nature Immunology. 18(7): 711-712.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us