Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADGRA3
ADGRA3, also known as adhesion G protein-coupled receptor A3 or G-protein coupled receptor 125 (GPR125), is a protein that encoded by the human GPR125 gene. As a member of the adhesion G protein-coupled receptor family, ADGRA3 has a long extracellular subunit with protein-protein interacting domains and a GPCR subunit. The last four amino acids (ETTV) of Gpr125 constitute a PDZ-binding motif, which is also found in the transmembrane PCP pathway components Frizzled and Vangl2.
| Basic Information of ADGRA3 | |
| Protein Name | Adhesion G protein-coupled receptor A3 |
| Gene Name | ADGRA3 |
| Aliases | G-protein coupled receptor 125 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q8IWK6 |
| Transmembrane Times | 7 |
| Length (aa) | 1321 |
| Sequence |
MEPPGRRRGRAQPPLLLPLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAEGKVVCSSLEL AQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNR IGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVR DTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQD GRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCP PERVVNNKGDFRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIA SNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVF QKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKQKRELRPTD DSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAV AARWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIIL LLCLLAVIVSYIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATV LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPNAPYCW MAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEINHQDSMSLSL ISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLDLVFSFVFGATSLSFSAFFVVHHCVNR EDVRLAWIMTCCPGRSSYSVQVNVQPPNSNGTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQA AAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREY AYDVPTSVEGSVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTT SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETTV |
Function of ADGRA3 Membrane Protein
During the past years, the expression of ADGRA3 has been found in diverse human tissues, including but not limited to thyroid, liver, and other tissues. It has been reported that ADGRA3 can be used as a novel modulator of the Wnt/planar cell polarity signaling system as it can functionally interact with multiple Wnt/PCP components. What’s more, studies have shown that excess Gpr125 could impair convergence and extension (C&E) movements and the underlying cell and molecular polarities. The reduced Gpr125 function may exacerbate the C&E and facial branchiomotor neuron (FBMN) migration defects of embryos with reduced Wnt/planar cell polarity signaling. Most importantly, this membrane protein may play a role in tumor angiogenesis through its interaction with the human homolog of the Drosophila disc large tumor suppressor gene.
Fig.1 Schematic view of the overall structure of a G protein-coupled receptor (GPCR), with depiction of the connectivity of the intracellular (IL) and extracellular (EL) loops between helices (H). (Fossépré, 2014)
Application of ADGRA3 Membrane Protein in Literature
1. Sachs C, et.al. Evaluation of candidate spermatogonial markers ID4 and GPR125 in testes of adult human cadaveric organ donors. Andrology. 2014, 2(4): 607-14. PubMed ID: 24902969
This article suggests that ADGRA3 is useful for identifying previously unrecognized human spermatogonial subpopulations in conjunction with other putative human stem cell markers, both in younger and older donors.
2. Fu JF, et.al. Involvement of Gpr125 in the myeloid sarcoma formation induced by cooperating MLL/AF10 (OM-LZ) and oncogenic KRAS in a mouse bone marrow transplantation model. International journal of cancer. 2013, 133(8): 1792-802. PubMed ID: 23564351
This article reveals that upregulation of ADGRA3 by cooperating MLL/AF10 (OM-LZ) and KRASG12C could promote cell adhesion and contribute to the MS formation.
3. Li X, et.al. Gpr125 modulates Dishevelled distribution and planar cell polarity signaling. Development. 2013, 140(14): 3028-39. PubMed ID: 23821037
This article reveals the role of ADGRA3 in PCP-mediated processes. The ADGRA3 intracellular domain directly could interact with Dvl. Moreover, ADGRA3 is able to recruit a subset of PCP components into membrane subdomains, suggesting that ADGRA3 may modulate the composition of Wnt/PCP membrane complexes.
4. Pickering C, et.al. The Adhesion GPCR GPR125 is specifically expressed in the choroid plexus and is upregulated following brain injury. BMC Neuroscience. 2008, (1): 97. PubMed ID: 18834514
This article indicates that GPR125 may play a functional role in choroidal and hippocampal response to injury.
5. Seandel M, et.al. Niche players: spermatogonial progenitors marked by GPR125. Cell Cycle. 2008, 7(2): 135-40. PubMed ID: 18256534
This article reveals that GPR125 could be used as a novel target for purifying adult stem and progenitors from tissues, with the goal of developing autologous multipotent cell lines.
ADGRA3 Preparation Options
With our versatile Magic™ membrane protein production platform and years of experience in the field of membrane protein preparation, we provide many flexible options for worldwide clients. Our target proteins can be presented in both reconstitution forms and multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRA3 antibody development services.
Creative Biolabs is determined to deliver the most satisfactory membrane protein preparation service to our worldwide clients. If you are interested in the service we can provide, please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
