ADGRE1 Membrane Protein Introduction

Introduction of ADGRE1

ADGRE1, also known as EGF-like module receptor 1 (EMR1) or EGF-like module-containing mucin-like hormone receptor-like 1, is a protein encoded by the ADGRE1 gene. As a member of the adhesion GPCR family, ADGRE1 has a domain resembling seven transmembrane G protein-coupled hormone receptors (7TM receptors) at its C-terminus. And the N-terminus of the encoded protein has six EGF-like modules, separated from the transmembrane segments by a serine/threonine-rich domain, a feature reminiscent of mucin-like, single-span, integral membrane glycoproteins with adhesive properties.

Basic Information of ADGRE1
Protein Name	Adhesion G protein-coupled receptor E1
Gene Name	ADGRE1
Aliases	EGF-like module receptor 1, EGF-like module-containing mucin-like hormone receptor-like 1, EMR1 hormone receptor
Organism	Homo sapiens (Human)
UniProt ID	Q14246
Transmembrane Times	7
Length (aa)	886
Sequence	MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNH FKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSS VCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHL SFQGLKASCEDIDECTEMCPINSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCG PNSICTNALGSYSCGCIAGFHPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFC AQINNIFSVLDKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKP SANITPAVRTEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVL NERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGG RWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDFSLYIISHVGIIISLVCLVLAIATFLLCRSI RNHNTYLHLHLCVCLLLAKTLFLAGIHKTDNKMGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVV NYFSSRNIKMLHICAFGYGLPMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVINSLLLT WTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFI FLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG

Function of ADGRE1 Membrane Protein

During the past years, ADGRE1 has been widely studied. It has been reported that the expression of ADGRE1 in human is mainly restricted to eosinophils and it is a specific marker for these cells. And the murine homolog of ADGRE1, which is well known as F4/80, has been widely used as a specific marker of murine macrophage populations. In the adult, F4/80 is dim on both resident and inflammatory monocyte subsets in the steady state. It is highly expressed on sinusoidal Mfs in liver (Kupffer cells), spleen and adrenal glands, as well as on extravascular Mfs in all tissues, including microglia and Langerhans cells. What’s more, the N-terminal fragment (NTF) of EMR1 contains 4-6 Epidermal Growth Factor-like (EGF-like) domains in human and 4-7 EGF-like domains in the mouse. It is not necessary for the development of tissue macrophages but is required for the induction of efferent CD8⁺ regulatory T cells needed for peripheral tolerance.

Fig.1 Proposed mechanism of heparin-binding EGF-like growth factor (HB-EGF) expression and macrophage recruitment in cervical cancer. (Schrevel, et.al. 2017)

Application of ADGRE1 Membrane Protein in Literature

1. Dos Anjos Cassado A. F4/80 as a major macrophage marker: the case of the peritoneum and spleen. Results Probl Cell Differ. 2017, 62: 161-179. PubMed ID: 28455709

This article proves that there is still a need to examine additional molecules to identify tissue macrophages even though F4/80 surface expression is the most effective method.

2. Arora M, et.al. LPS-induced CD11b⁺Gr1^intF4/80⁺ regulatory myeloid cells suppress allergen-induced airway inflammation. International Immunopharmacology. 2011, 11(7): 827-32. PubMed ID: 21320637

This article provides a complete understanding of the generation and regulation of the Gr1(int) cells would provide new avenues to either promote or delete these cells for disease-specific immunoregulation.

3. Lin HH, et.al. F4/80: the macrophage-specific adhesion-GPCR and its role in immunoregulation. Adv Exp Med Biol. 2010, 706: 149-56. PubMed ID: 21618834

This article suggests that F4/80 receptor plays a key role in immunoregulation for it is necessary for the induction of efferent CD8⁺ regulatory T cells responsible for peripheral immune tolerance.

4. Van den Berg TK, Kraal G. A function for the macrophage F4/80 molecule in tolerance induction. Trends in immunology. 2005, 26(10): 506-9. PubMed ID: 16087400

This article reveals that theF4/80molecule is a vital role in the immune system.

ADGRE1 Preparation Options

Based on years of experience and advanced Magic™ membrane protein production platform, Creative Biolabs is able to provide many flexible options for membrane protein preparation. Our experienced scientists will help you obtain the soluble and functional target protein in both reconstitution forms and multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRE1 antibody development services.

Creative Biolabs is dedicated to offering customized membrane protein production services for our customers. We are happy to welcome customers all over the world to consult and discuss their projects with our professional scientists. Please feel free to contact us for more information.

Reference

Schrevel, et.al. (2017). Autocrine expression of the epidermal growth factor receptor ligand heparin-binding EGF-like growth factor in cervical cancer. International journal of oncology, 50(6), 1947-1954.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: