Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADGRG5
ADGRG5, also known as G-protein coupled receptor 114 (GPR114) or G-protein coupled receptor PGR27 (PGR27), is a protein encoded by the ADGRG5 gene. It is a member of the adhesion GPCR family which are characterized by an extended extracellular region with a variable number of protein domains coupled to a TM7 domain via a domain known as the GPCR-Autoproteolysis INducing (GAIN) domain.
| Basic Information of ADGRG5 | |
| Protein Name | Adhesion G-protein coupled receptor G5 |
| Gene Name | ADGRG5 |
| Aliases | G-protein coupled receptor 114, G-protein coupled receptor PGR27 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q8IZF4 |
| Transmembrane Times | 7 |
| Length (aa) | 528 |
| Sequence |
MDHCGALFLCLCLLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQT PTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTH FFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCR TEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSL TRIHMNLHASVLLLNIAFLLSPAFAMSPVPGSACTALAAALHYALLSCLTWMAIEGFNLYLLLGRVYNIY IRRYVFKLGVLGWGAPALLVLLSLSVKSSVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLVMGYG GLTSLFNLVVLAWALWTLRRLRERADAPSVRACHDTVTVLGLTVLLGTTWALAFFSFGVFLLPQLFLFTI LNSLYGFFLFLWFCSQRCRSEAEAKAQIEAFSSSQTTQ |
Function of ADGRG5 Membrane Protein
The G protein-coupled receptors (GPCRs) are a large family of integral membrane proteins that generally act as cell surface receptors responsible for the transduction of a remarkable diversity of endogenous signals into a cellular response. Expression of some adhesion GPCR subfamilies initially appeared confined to distinct cell types or organs, like the immune system or the central nervous system (CNS). As a member of GPCRs, ADGRG5 has the basic molecular architecture with seven hydrophobic regions of 25-35 consecutive residues. Studies have shown that ADGRG5 is specifically expressed in human eosinophils as well as in mouse lymphocytes, monocytes, macrophage, and dendritic cells. And, a variant (rs9937918) of ADGRG5 has been found to be associated with differences in vitamin D3 metabolism. What’s more, it has been reported that ADGRG5 may also have the ability to mediate hematopoietic stem cell repopulation and retention of myeloid cells within the bone marrow niche.
Application of ADGRG5 Membrane Protein in Literature
1. Stoveken HM., et.al. Gedunin-and Khivorin-Derivatives Are Small-Molecule Partial Agonists for Adhesion G Protein-Coupled Receptors GPR56/ADGRG1 and GPR114/ADGRG5. Molecular pharmacology. 2018, 93(5): 477-88. PubMed ID: 29476042
This article finds a novel group of aGPCR partial agonists that will serve as invaluable resources for understanding the unique class receptors.
2. Wilde C., et.al. The constitutive activity of the adhesion GPCR GPR114/ADGRG5 is mediated by its tethered agonist. The FASEB Journal. 2015, 30(2): 666-73. PubMed ID: 26499266
This article suggests that the N-terminal half of the Stachel sequence confers the agonistic activity, whereas the C-terminal part orientates the agonistic core sequence to the transmembrane domain. It indicates that the proposed mechanism of Stachel-mediated activation is relevant not only to GPR114 but to a GPCRs in general.
ADGRG5 Preparation Options
To satisfy every client’s specific requirements, we have developed versatile Magic™ membrane protein production platform which enables us to provide a series of membrane protein preparation service in multiple active formats. We can provide many flexible options, from which you can find a perfect one for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRG5 antibody development services.
Equipped with multiple leading technology platforms, Creative Biolabs is committed to delivering satisfactory membrane protein products for worldwide customers. In addition to ADGRG5 membrane protein production, we also provide other membrane protein products in the most high-quality and cost-effective way. For more detailed information, please feel free to contact us and get a quote.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
