Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADGRL4
Adhesion G protein-coupled receptor L4 (ADGRL4), also known as ETL, ELTD1 or KPG_003, is encoded by the ELTD1 gene. Based on its sequence, ADGRL4 is a member of the secretin family of G protein-coupled peptide hormone receptors and belongs to the epidermal growth factor 7-transmembrane (EGF-TM7) subfamily. ADGRL4 plays a role in angiogenesis, both physiological and pathological, as well as glioblastoma and the protein levels of ADGRL4 are significantly higher in humans and rodent gliomas. Structurally, it contains a large extracellular domain with EGF-like repeats, a seven transmembrane domain, and a short cytoplasmic tail.
| Basic Information of ADGRL4 | |
| Protein Name | Adhesion G protein-coupled receptor L4 |
| Gene Name | ADGRL4 |
| Aliases | EGF, latrophilin and seven transmembrane domain-containing protein 1, EGF-TM7-latrophilin-related protein, ETL protein, ELTD1, ETL |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9HBW9 |
| Transmembrane Times | 7 |
| Length (aa) | 690 |
| Sequence |
MKRLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNV CIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTI SAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSF QKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFV YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHR KVTDRYRSLCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIG IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR |
Function of ADGRL4 Membrane Protein
ADGRL4 is discovered to be developmentally regulated in rat fetal and postnatal cardiomyocytes and has also been identified as a ligand dermatan sulfate in rheumatoid synovial tissue in patients with rheumatoid arthritis. More importantly, ADGRL4 has been associated as an endothelial marker in microvasculature. Specificity of the ADGRL4 probe may be in areas associated with neovascularization. Compared with low-grade gliomas, ADGRL4 is significantly higher in high-grade gliomas. This marker can be used to identify high-grade glioma tissues, which is better than traditional immunohistochemical (IHC) markers, traditional immunohistochemistry (IHC)-inducible factor-1α of oxygen-inducible factor 9. ADGRL4 gene expression is associated with tumor grade, survival across grades, and an increase in mesenchymal subtypes.
Fig.1 ELTD1’s putative structure and conservation. (Favara DM, et al. 2014)
Application of ADGRL4 Membrane Protein in Literature
1. Ziegler J., et.al. ELTD1, an effective anti-angiogenic target for gliomas: preclinical assessment in mouse GL261 and human G55 xenograft glioma models. Neuro Oncol. 2017, 19(2): 175-185. PubMed ID: 27416955
Authors in this group discovered a new biomarker for high-grade gliomas, ELTD1 via bioinformatics, and validated that ELTD1 protein levels are significantly higher in human and rodent gliomas. Anti-ELTD1 antibodies could be a valuable new clinical anti-angiogenic therapeutic for high-grade gliomas.
2. Lu S., et.al. Developmental vascular remodeling defects and postnatal kidney failure in mice lacking Gpr116 (Adgrf5) and Eltd1 (Adgrl4). PLoS One. 2017, 12(8): e0183166. PubMed ID: 28806758
This article reveals that the absence of ELTD1 and GPR116 showed malformations of the aortic arch arteries and the cardiac outflow tract leading to approximately 50% of mutant perinatal lethality. This indicates that loss of GPR116 and ELTD1 expressed accounts for the observed cardiovascular and renal defects.
3. Dai S., et.al. MicroRNA-139-5p acts as a tumor suppressor by targeting ELTD1 and regulating cell cycle in glioblastoma multiforme. Biochem Biophys Res Commun. 2015, 467(2): 204-10. PubMed ID: 26449464
The article reports that ectopic expression of miR-139-5p in GBM cell lines significantly suppressed cell proliferation and inducing apoptosis. Therefore, miR-139-5p can be used to suppresses glioma cell proliferation via targeting ELTD1 and regulating cell cycle.
4. Masiero M., et.al. A core human primary tumor angiogenesis signature identifies the endothelial orphan receptor ELTD1 as a key regulator of angiogenesis. Cancer Cell. 2013, 24(2): 229-41. PubMed ID: 23871637
Authors in this group identified the expression of ELTD1 is induced by VEGF/bFGF and repressed by DLL4 signaling. ELTD1 is believed to play an important role in blood vessel formation.
5. Towner RA., et.al. ELTD1, a potential new biomarker for gliomas. Neurosurgery. 2013, 72(1): 77-90. PubMed ID: 23096411
The study suggests that ELTD1 is a putative glioma-associated biomarker, which may serve as an additional biomarker for preclinical and clinical diagnosis of gliomas.
ADGRL4 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRL4 antibody development services.
Creative Biolabs is a world-renowned service and product provider for membrane proteins. After years of pursuit for perfection, Creative Biolabs has established leadership in membrane protein research and we are happy to provide a highly flexible and comprehensive one-stop-shop for our customers. Please do not hesitate to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
