Close

ADORA1 Membrane Protein Introduction

Introduction of ADORA1

The adenosine A1 receptor (ADORA1) belongs to the adenosine receptor group of G protein-coupled receptors which use adenosine as endogenous ligand. The A1 receptor includes A2A, A2B, and A3 and displays high expression levels in the brain (cortex, cerebellum, hippocampus), dorsal horn of the spinal cord, eye and atria. ADORA1 is encoded by the ADORA1 gene. An important paralog of this gene is ADORA2A.

Basic Information of ADORA1
Protein Name Adenosine receptor A1
Gene Name ADORA1
Aliases A1R
Organism Homo sapiens (Human)
UniProt ID P30542
Transmembrane Times 7
Length (aa) 326
Sequence MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD

Function of ADORA1 Membrane Protein

A1 receptors participate in sleep promotion by inhibiting arousal of cholinergic neurons in the basal forebrain and also present in the smooth muscle of the entire vascular system. Agonists activate adenosine A1 receptors to cause binding of Gi1 / 2/3 or Go proteins, resulting in inhibition of adenylate cyclase and reduction of cAMP concentration. The increase in inositol triphosphate/diglyceride concentration is caused by the activation of phospholipase C. DAG lipase mediates elevated arachidonic acid levels, and DAG lipase cleaves DAG to form arachidonic acid. Several types of potassium channels are activated, but N-, P- and Q-type calcium channels are inhibited. Endogenous adenosine A1 and A2A receptors are believed to play a role in regulating myocardial oxygen consumption and coronary blood flow. Since the decrease in A1 expression appears to prevent hypoxia-induced ventricular dilatation and white matter loss, the pharmacological blockade of A1 may have clinical utility.

Adenosine formation and catabolism.Fig.1 Adenosine formation and catabolism. (Sachdeva, 2013)

Application of ADORA1 Membrane Protein in Literature

1. El-Hashim A Z., et al. Central adenosine A1 receptors inhibit cough via suppression of excitatory glutamatergic and tachykininergic neurotransmission. Br J Pharmacol. 2018, 175(15): 3162-3174. PubMed ID: 29767468

This article reveals that ADORA1 mediates several excitatory effects in the airways and has inhibitory effects in the central nervous system. ADORA1 may be useful in regulating cough and airway obstruction.

2. Beste A., et al. Mechanisms of acetylcholinesterase protection against sarin and soman by adenosine A1 receptor agonist N6-cyclopentyladenosine. Comput Biol Chem. 2018, 75: 74-81. PubMed ID: 29747078

Authors in this group have demonstrated that alternative acute treatment with the adenosine A1 receptor agonist N6-cyclopentyladensosine (CPA) could prevent AChE inhibition as well as to suppress neuronal activity. They try to explain the mechanisms of acetylcholinesterase protection against sarin and soman by ADORA1 agonist N6-cyclopentyladenosine.

3. Mitani T., et al. Theobromine suppresses adipogenesis through enhancement of CCAAT-enhancer-binding protein β degradation by adenosine receptor A1. Biochim Biophys Acta. 2017, 1864(12): 2438-2448. PubMed ID: 28965824

The article reports that theobromine selectively interacts with ADORA1 and ADORA1 knockdown inhibits theobromine-induced C/EBPβ degradation. The inhibition of ADORA1 signaling is essential for theobromine-induced C/EBPβ degradation.

4. Luan G., et al. Upregulation of Neuronal Adenosine A1 Receptor in Human Rasmussen Encephalitis. J Neuropathol Exp Neurol. 2017, 76(8): 720-731. PubMed ID: 28789481

This article focuses on the role adenosine A1 receptor plays in human Rasmussen encephalitis. It shows that over-expression of adenosine kinase is a common pathologic hallmark of Rasmussen encephalitis, and that upregulation of neuronal A1R in Rasmussen encephalitis is crucial in preventing the spread of seizures.

5. Riff R., et al. Systemic inflammatory response syndrome-related lymphopenia is associated with adenosine A1 receptor dysfunction. J Leukoc Biol. 2017, 102(1): 95-103. PubMed ID: 28495790

This article evaluates the role of adenosine in SIRS-mediated lymphopenia and impaired IL-15 production. They suggest that systemic inflammatory response syndrome-related lymphopenia is associated with adenosine A1 receptor dysfunction and interference with adenosine signaling may thus be potentially beneficial for septic patients with leukopenia.

ADORA1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADORA1 antibody development services.


As a world-leading member protein provider, Creative Biolabs now offers all-around, custom-oriented service of Magic™ membrane protein production. We are happy to leverage our advanced techniques and extensive expertise in this field to satisfy every single custom demand. Please do not hesitate to contact us for more information.

Reference

  1. Sachdeva S and Gupta M. (2013). Adenosine and its receptors as therapeutic targets: An overview. Saudi Pharm J. 21(3), 245-53.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us