Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADORA2A
ADORA2A is encoded by ADORA2A gene. It belongs to the G-protein-coupled receptor (GPCR) family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It is one of the four subtypes of adenosine receptors (A1R, A2AR, A2BR, A3R). ADORA2A possess seven transmembrane alpha helices and uses adenosine as the preferred endogenous agonist. Meanwhile, its structure reveals a ligand binding pocket distinct from that of other structurally determined GPCRs.
| Basic Information of ADORA2A | |
| Protein Name | Adenosine receptor A2a |
| Gene Name | ADORA2A |
| Aliases | Adenosine A2a receptor, A2aR, ADORA2, RDC8 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P29274 |
| Transmembrane Times | 7 |
| Length (aa) | 412 |
| Sequence |
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGF CAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPM LGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQ MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTN SVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGS APHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
Function of ADORA2A Membrane Protein
The activity of ADORA2A is mediated by G proteins, resulting in the activation of adenylyl cyclase and elevating intracellular cAMP. ADORA2A plays a vital role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. Since ADORA2A is enriched in brains and involves in the regulation of glutamate and dopamine release, it is a potential therapeutic target of certain neurological diseases such as insomnia, pain regulation, depression, drug addiction, and Parkinson's disease. It is also a major target of caffeine, which is a competitive antagonist of this protein. Besides, ADORA2A is also abundant in vasculature and platelets and participates in the regulation of myocardial oxygen consumption and blood pressure. It is supposed to regulate myocardial oxygen demand and to increase the coronary circulation by vasodilation. In addition, it can negatively regulate over-reactive immune cells and protect tissues from collateral inflammatory damages by suppressing immune cells.
Fig.1 Structure of ADORA2A membrane protein.
Application of ADORA2A Membrane Protein in Literature
1. Domenici M.R., et al. Neuronal adenosine A2A receptor overexpression is neuroprotective towards 3-nitropropionic acid-induced striatal toxicity: a rat model of Huntington's disease. Purinergic Signal. 2018, 14(3): 235-243. PubMed ID: 29770921
This article reports that the selective overexpression of ADORA2A at the neuronal level reduced 3-NP-induced neurodegeneration, which suggests an important function of the neuronal ADORA2A in the modulation of neurodegeneration.
2. Zheng Z., et al. Lumbar sympathectomy reduces vascular permeability, possibly through decreased adenosine receptor A2a expression in the hind plantar skin of rats. Clin Hemorheol Microcirc. 2018, 68(1): 5-15. PubMed ID: 29439317
This article reveals that reduced expression of ADORA2A is possibly related to that vascular permeability in the hind plantar skin of rats decreases following lumbar sympathectomy.
3. Caliman A.D., et al. Mapping the allosteric sites of the A2A adenosine receptor. Chem Biol Drug Des. 2018, 91(1): 5-16. PubMed ID: 28639411
Authors in this group apply the fragment-based mapping algorithm, FTMap, on the conformations of ADORA2A and uncover five non-orthosteric sites on the ADORA2A. These sites are potential for the treatment of inflammatory and neurological diseases.
4. Schulz N., et al. Critical role for adenosine receptor A2a in β-cell proliferation. Mol Metab. 2016, 5(11): 1138-1146. PubMed ID: 27818940
This article focuses on the pharmacological activation of adenosine signaling in β-cell proliferation in zebrafish. It shows that A2a receptor plays an important role in adenosine signaling and compensatory β-cell proliferation. Meanwhile, this feature can be used in future therapeutic development for diabetes.
5. Li H., et al. Pentoxifylline inhibits pulmonary inflammation induced by infrarenal aortic cross-clamping dependent of adenosine receptor A2A. Am J Transl Res. 2016, 8(5): 2210-21. PubMed ID: 27347328
This article evaluates the protective effects of pentoxifylline in a rat model of infrarenal aortic cross-clamping (IAC), which is commonly used during infrarenal vascular operations. It indicates that pentoxifylline plays a protective role in IAC-induced acute lung injury in rats by inhibiting pulmonary inflammation and ADORA2A participates in this regulation through A2A signaling pathways.
ADORA2A Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADORA2A antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
