Close

ADORA2B Membrane Protein Introduction

Introduction of ADORA2B

Adenosine receptor A2b (ADORA2B) is a protein that in human is encoded by the ADORA2B gene. ADORA2B is a member of the adenosine receptor group of G-protein-coupled receptors that also includes A1, A2A, and A3. The ADORA2B gene, which is located near the Smith-Magenis syndrome region on chromosome 17, encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein not only stimulates adenylate cyclase activity in the presence of adenosine but also interacts with netrin-1 that is involved in axon elongation. Among the related pathways of the protein, ADORA2B are Nucleotide-like (purinergic) receptors and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and G-protein coupled adenosine receptor activity. An important paralog of this gene is ADORA2A.

Basic Information of ADORA2B
Protein Name Adenosine receptor A2b
Gene Name ADORA2B
Aliases ADORA2, A2B-AR
Organism Homo sapiens (Human)
UniProt ID P29275
Transmembrane Times 7
Length (aa) 332
Sequence MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCT
DFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNS
KDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELM
DHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAY
RNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL

Function of ADORA2B Membrane Protein

Activation of ADORA2B occurs with high extracellular adenosine concentration, such as in inflammation or hypoxia. These conditions are generated in the tumor environment. ADORA2B not only exerts immunomodulatory effects that protect tumor cells but also participates in different events, such as angiogenesis and metastasis. ADORA2B receptors display high expression levels in the bladder, colon, and cecum, with lower levels in the blood vessels, lung, and eye. Activated macrophages (AAMs) expressing ADORA2B have been implicated in mediating adenosine's effects in Idiopathic pulmonary fibrosis (IPF) and HIF1A up-regulates the ADORA2B receptor on alternatively activated macrophages and contributes to pulmonary fibrosis. ADORA2B plays an important anti-inflammatory role in the lung. CXCR4- and CXCR7-inhibition had a synergistic effect in acute pulmonary inflammation, which depended on A2B-receptor signaling. Meanwhile, A2BAR signaling may play a protective role in countering ischemic lung injury.

A Model for the Stimulation of Glycolysis in the Heart by Adora2b.Fig.1 A Model for the Stimulation of Glycolysis in the Heart by Adora2b. (Lopaschuk, 2012)

Application of ADORA2B Membrane Protein in Literature

1. Philip K., et al. HIF1A up-regulates the ADORA2B receptor on alternatively activated macrophages and contributes to pulmonary fibrosis. FASEB J. 2017, 31(11): 4745-4758. PubMed ID: 28701304

This article reports that HIF1A up-regulates the ADORA2B receptor on alternatively activated macrophages and contributes to pulmonary fibrosis. ADORA2B deletion or pharmacological antagonism along with HIF1A inhibition disrupts AAM differentiation and subsequent IL-6 production in cultured macrophages.

2. Konrad FM., et al. Inhibition of SDF-1 receptors CXCR4 and CXCR7 attenuates acute pulmonary inflammation via the adenosine A2B-receptor on blood cells. Cell Death Dis. 2017, 8(5): e2832. PubMed ID: 28542132

Authors in this group investigated the particular role of CXCR4- and CXCR7-inhibition and the potential link to the adenosine A2B-receptor, which plays an important anti-inflammatory role in the lung.

3. Densmore JC., et al. Lung injury pathways: Adenosine receptor 2B signaling limits development of ischemic bronchiolitis obliterans organizing pneumonia. Exp Lung Res. 2017, 43(1): 38-48. PubMed ID: 28266889

This article studies the role of adenosine signaling in bronchiolitis obliterans organizing pneumonia (BOOP) resulting from unilateral lung ischemia. It shows that A2BAR signaling may play a protective role in countering ischemic lung injury.

4. Mølck C., et al. The A2b adenosine receptor antagonist PSB-603 promotes oxidative phosphorylation and ROS production in colorectal cancer cells via adenosine receptor-independent mechanism. Cancer Lett. 2016, 383(1): 135-143. PubMed ID: 27693637

Authors in this group analyze the contribution of the A2b-AR to the behavior of colorectal cancer cells. The results show that the A2b-AR antagonist, PSB-603, may have clinical value as anti-colorectal cancer therapeutic.

5. Sorrentino C., et al. Activation of the A2B adenosine receptor in B16 melanomas induces CXCL12 expression in FAP-positive tumor stromal cells, enhancing tumor progression. Oncotarget. 2016, 7(39): 64274-64288. PubMed ID: 27590504

This article reveals an important role for A2BR in stimulating FGF2 and CXCL12 expression in melanoma-associated fibroblasts, which contributes to creating a tumor-promoting microenvironment.

ADORA2B Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADORA2B antibody development services.


As a world-renowned service and product provider for membrane proteins, Creative Biolabs has established leadership in membrane protein research. We are happy to provide a highly flexible and comprehensive one-stop-shop for our customers. Please feel free to contact us for more information.

Reference

  1. Lopaschuk GD and Jaswal JS. (2012). A role for period 2 in cardioprotection. Cell Metab. 16(1), 2-4.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us