Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADRA1D
Alpha-1-adrenergic receptor (alpha-1-ARs) is a member of the G protein-coupled receptor superfamily. 3 alpha-1-AR subtypes are divided into alpha1A, alpha1B and alpha1D receptors. All subtypes signal through the Gq/11 family of G-proteins but show different patterns of activation. They activate mitogenic responses and regulate growth and proliferation of many cells. Adrenoceptor Alpha 1B (ADRA1D) is encoded by the gene ADRA1D. ADRA1D is regulated by Alpha-1 adrenergic receptors and Monoamine GPCRs. Gene Ontology annotations related to ADRA1A include alpha1-adrenergic receptor activity and G-protein coupled receptor activity.
| Basic Information of ADRA1D | |
| Protein Name | Alpha-1D adrenergic receptor |
| Gene Name | ADRA1D |
| Aliases | Alpha-1A adrenergic receptor, Alpha-1D adrenoreceptor, Alpha-1D adrenoceptor, Alpha-adrenergic receptor 1a, ADRA1A |
| Organism | Homo sapiens (Human) |
| UniProt ID | P25100 |
| Transmembrane Times | 7 |
| Length (aa) | 572 |
| Sequence |
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI |
Function of ADRA1D Membrane Protein
Currently, 1-adrenoceptors are divided into three recognizable subtypes (1A, 1B, and 1D), and the importance of 1D -adrenoceptor subtypes in the overall control of micturition has been clinically established. 1D-Adrenoceptors are the predominant receptor subtype (present at twice the level of the other 1-subtypes) in sacral ventral motor neurons and autonomic parasympathetic pathways. It has been shown that blocking of the 1D-adrenoceptor subtype reduces the urethral resistance associated with Detrusor-sphincter dyssynergia, leading to the improvement in voiding efficiency in spinal cord injury (SCI) rats. These results suggest that 1D-blockers may be effective for treating storage and voiding symptoms in SCI patients.
Fig.1 Alpha-1-adrenergic receptors.
Application of ADRA1D Membrane Protein in Literature
1. Ishida H., et al. α1D-Adrenoceptor blockade increases voiding efficiency by improving external urethral sphincter activity in rats with spinal cord injury. Am J Physiol Regul Integr Comp Physiol. 2016, 311(5): R971-R978. PubMed ID: 27605559
Authors in this group investigated blockade of various α-adrenoceptors to determine the subtype that was principally responsible for improving the voiding dysfunction. Data shows that α1D-Adrenoceptor blockade increases urinary excretion efficiency via improving the activity of extra-urethral sphincter in rats with spinal cord injury.
2. Alfonzo-Méndez MA., et al. Carboxyl terminus-truncated α1D-adrenoceptors inhibit the ERK pathway. Naunyn Schmiedebergs Arch Pharmacol. 2016, 389(8): 911-20. PubMed ID: 27146292
The article reports that the absence of the human α1D-adrenoceptor carboxyl tail results in altered ERK (extracellular signal-regulated kinase) and p38 phosphorylation states.
3. Colciago A., et al. A selective alpha1D-adrenoreceptor antagonist inhibits human prostate cancer cell proliferation and motility "in vitro". Pharmacol Res. 2016, 103: 215-26. PubMed ID: 26621245
The results reveal some cellular aspects promoted by alpha1D-AR activity modulation. The selective alpha1D-adrenoreceptor antagonist is capable of inhibiting human prostate cancer cell proliferation and motility.
4. Kandasamy K., et al. Erythropoietin Reverses Sepsis-Induced Vasoplegia to Norepinephrine Through Preservation of α1D-Adrenoceptor mRNA Expression and Inhibition of GRK2-Mediated Desensitization in Mouse Aorta. J Cardiovasc Pharmacol Ther. 2016, 21(1): 100-13. PubMed ID: 26025460
Authors in this group investigated the effect of erythropoietin (EPO) posttreatment on survival time and vascular functions in a mouse model of sepsis. Erythropoietin significantly preserved the α1D receptor expression and restored NE-induced contractions to control levels in septic mice.
5. Morelli MB., et al. Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation. BMC Cancer. 2014, 14: 921. PubMed ID: 25481381
This article reveals a cross-talk between alpha1D-AR and transient receptor potential vanilloid type 1 (TRPV1). It shows that the cross-talk between alpha1D-AR and TRPV1 triggers prostate cancer cell proliferation.
ADRA1D Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADRA1D antibody development services.
As an expert who can provide professional custom service in membrane proteins, Creative Biolabs is happy to leverage our advanced techniques and extensive expertise in this field to satisfy every single custom demand. If you are interested, please do not hesitate to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
