Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADRA2A
The alpha-2A adrenergic receptor (ADRA2A), which in humans is encoded by the ADRA2A gene, is an α2 adrenergic receptor. The gene ADRA2A encodes α2A subtype and it contains no introns in either its coding or untranslated sequences. α2 adrenergic receptors can be divided into 3 highly homologous subtypes: α2A, α2B, and α2C, which are important in regulating neurotransmitter release from sympathetic nerves and adrenergic neurons in the central nervous system.
| Basic Information of ADRA2A | |
| Protein Name | Alpha-2A adrenergic receptor |
| Gene Name | ADRA2A |
| Aliases | Alpha-2 adrenergic receptor subtype C10, Alpha-2A adrenoreceptor, Alpha-2A adrenoceptor, Alpha-2AAR, ADRA2R, ADRAR |
| Organism | Homo sapiens (Human) |
| UniProt ID | P08913 |
| Transmembrane Times | 7 |
| Length (aa) | 450 |
| Sequence |
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS LNPVIYTIFNHDFRRAFKKILCRGDRKRIV |
Function of ADRA2A Membrane Protein
Several diseases are associated with ADRA2A, such as Horner's Syndrome and Gilles De La Tourette Syndrome. Among its related pathways are response to elevated platelet cytosolic Ca2+ and Monoamine GPCRs. Many post-synaptic α2A receptors play important roles in brain function. α2A receptors are localized on prefrontal cortical neurons in which they regulate higher cognitive function. α2 adrenoreceptors (α2-ARs) play a key role in the control of noradrenaline and dopamine release in the medial prefrontal cortex (mPFC). The ADRA2A rs553668 variant is also associated with type 2 diabetes. Adrenaline physiologically exerts its insulinostatic action via α2A-adrenoceptor-mediated attenuation of TRPM2 channels. α2A-adrenergic is also associated with osteoarthritis. Activation of α2A-adrenergic signal transduction in chondrocytes promotes degenerative remodeling of temporomandibular joint.
Fig.1 Responses that can be mediated by α2-adrenergic receptors. (Takahiko, 2000)
Application of ADRA2A Membrane Protein in Literature
1. Totomoch-Serra A., et al. The ADRA2A rs553668 variant is associated with type 2 diabetes and five variants were associated at nominal significance levels in a population-based case-control study from Mexico City. Gene. 2018. 669: 28-34. PubMed ID: 29800730
Authors in this group discovered that five variants of ADRA2A were associated at nominal significance levels in a population-based case-control study from Mexico City and the ADRA2A rs553668 variant is associated with type 2 diabetes.
2. Huang HC., et al. The Alpha-2A Adrenergic Receptor Gene - 1291C/G Single Nucleotide Polymorphism is Associated with the Efficacy of Methylphenidate in Treating Taiwanese Children and Adolescents with Attention-Deficit Hyperactivity Disorder. Psychiatry Investig. 2018, 15(3): 306-312. PubMed ID: 29486545
The article reports that the ADRA2A gene - 1291C/G SNP is associated with the efficacy of MPH for the treatment of ADHD in Taiwanese children and adolescents.
3. Ito K., et al. Endogenous α2A-Adrenoceptor-Operated Sympathoadrenergic Tones Attenuate Insulin Secretion via cAMP/TRPM2 Signaling. Diabetes. 2017, 66(3): 699-709. PubMed ID: 28028077
The article suggests that a physiological concentration of adrenaline attenuates insulin release via coupling of α2A-adrenoceptor to cAMP/TRPM2 signaling. The results provide a potential therapeutic tool to treat patients with type 2 diabetes.
4. Castelli MP., et al. α2A adrenergic receptors highly expressed in mesoprefrontal dopamine neurons. Neuroscience. 2016, 332: 130-9. PubMed ID: 27365174
Authors in this group investigated whether α2A-ARs might function as autoreceptors in the mesoprefrontal dopaminergic neurons, replacing the lack of D2 autoreceptors.
5. Adefurin A., et al. Alpha2A adrenergic receptor genetic variation contributes to hyperglycemia after myocardial infarction. Int J Cardiol. 2016, 215: 482-6. PubMed ID: 27131769
This article reveals that alpha2A adrenergic receptor genetic variation contributes to hyperglycemia after myocardial infarction. Three ADRA2A genetic variants in Caucasians are associated with blood glucose and stress-induced hyperglycemia after AMI.
ADRA2A Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADRA2A antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the membrane protein research. If you are interested, please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
