Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of AQP0
AQP0 is also known as lens fiber major intrinsic protein, MIP26, MP26, Aquaporin-CHIP, Urine water channel, water channel protein for red blood cells and kidney proximal tubule. It belongs to a family of water channels, expressed in all kingdoms of life, which facilitate the flux of water molecules across membranes. Humans express 13 AQP isoforms in tissue-specific manner differentially. Each isoform possesses unique substrate permeability characteristics and being regulated in different ways.
| Basic Information of AQP0 | |
| Protein Name | Aquaporin-0 |
| Gene Name | MIP |
| Aliases | Lens fiber major intrinsic protein, MIP26, MP26, Aquaporin-CHIP, Urine water channel |
| Organism | Homo sapiens (Human) |
| UniProt ID | P30301 |
| Transmembrane Times | 8 |
| Length (aa) | 263 |
| Sequence | MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL |
Function of AQP0 Membrane Protein
AQP0 is a water channel that is exclusively expressed in the mammalian eye lens and whose permeability is directly modulated by CaM. AQP0 serves a dual function in the lens by acting as a water channel or as an adhesive protein mediating cell-cell adhesive junctions. The Ca2+-dependent interaction between Ca2+–CaM and the cytoplasmic C-terminal domain of AQP0 regulates the water permeability. The binding of Ca2+/CaM to AQP0 results in the closing of partial pore. The phosphorylation of AQP0 by anchored PKA (AKAP2/PKA complex) can abolish the binding of CaM, which can keep AQP0 in the open conformation and functioning at maximal activity. AQP0 is expressed in the eye lens highly because it serves the critical function of maintaining the transparency of this organ required for our vision. The misregulation of AQP0 leads to a clouding of the eye lens, known as cataracts, which is the leading cause of blindness in the world.
Fig.1 Pseudoatomic model of the AQP0–CaM complex displaying two CaM molecules (Reichow, 2013).
Application of AQP0 Membrane Protein in Literature
Authors in this group apply EM to elucidate the pseudoatomic structure of full-length mammalian AQP0 in complex with CaM and how this signaling protein modulates water-channel function.
This article reports that structure of the AQP0 membrane junction as determined by electron crystallography. The junction is formed by three localized interactions between AQP0 molecules in adjoining membranes, mainly mediated by proline residues conserved in Aquaporin-0 from different species but not present in most other aquaporins.
Authors in this group use a combination of biochemical methods and NMR spectroscopy to probe the interaction between AQP0 and CaM in a calcium-dependent manner, which suggests possible structural co-operativity between monomers within the tetramer.
Authors in this group use a variety of cellular and biochemical approaches to discover that products of the A-kinase anchoring protein 2 gene (AKAP2/AKAP-KL) form a stable complex with AQP0 to sequester protein kinase A (PKA) with the channel.
This article shows that AQP0 could be an important component in establishing and/or maintaining the overall lens biomechanics for the first time.
AQP0 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-AQP0 antibody development services.
As a leading global biologics services provider that offers comprehensive, integrated and highly customizable services in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
