Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of C3AR1
C3AR1 (C3aR) is a G protein-coupled receptor protein involved in the complement system. This receptor binds to one of the anaphylatoxins, C3a, which is a complement-derived, cationic inflammatory peptide that can cause anaphylactic reactions. The C3aR is unique among the receptors of this family in that it has an unusually large extracellular domain between TM4 and TM5 (over 160 amino-acid residues). C3AR is expressed by many tissues including those of the central nervous system and by myeloid leukocytes such as neutrophils, eosinophils, basophils, mast cells, and monocytes/macrophages. Upon binding to the receptors, Ca3 exerts its biological actions by changing the conformation of the receptor and activating heterotrimeric G proteins. Subsequently, multiple intracellular kinases and small G proteins are activated, leading to diverse biological actions.
| Basic Information of C3AR1 | |
| Protein Name | C3a anaphylatoxin chemotactic receptor |
| Gene Name | C3AR1 |
| Aliases | C3ar, C3a-R |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q16581 |
| Transmembrane Times | 7 |
| Length (aa) | 482 |
| Sequence |
MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIW FLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDR CLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSS SLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSAD SLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSA SSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIV FRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNST TV |
Functions of C3AR1 Membrane Protein
The C3AR1 receptor has been found to modulate immunity, arthritis, diet-induced obesity, and cancers. Firstly, as the complement system is an essential component of the innate immune response, the Ca3R functions in the regulation of immunity. In addition, a 1526G/A single-nucleotide polymorphism (SNP) in human C3aR is associated with severity of childhood bronchial asthma and 1595 A/G with atopic dermatitis. Moreover, the expression of C3aR and C5aR is increased in fatal asthma. Additionally, C3aR and C5aR are found to be expressed in human atherosclerotic coronary plaques, but not in normal intimas, suggesting these two receptors as potential therapeutic targets of in acute coronary events. In other studies, it has been demonstrated that double deficiency of C5aR/C3aR significantly prevents mice from renal ischemia/reperfusion injury. Besides, C3aR contributes, at least in part, to the disease pathogenesis in human inflammatory bowel disease.
Applications of C3AR1 Membrane Protein in Literature
1. Amanda Crider., et al. Complement component 3a receptor deficiency attenuates chronic stress-induced monocyte infiltration and depressive-like behavior. Brain Behavior and Immunity. 2018, 70: 246-256. PMID: 29518530
This study investigated the role of complement components: C3 and C3aR in the pathophysiology of major depressive disorder (MDD). These preclinical studies suggest that C3aR may play a key factor in the MDD pathophysiology.
2. Litvinchuk A., et al. The role of complement c3 and c3ar receptor in tau pathology in Alzheimer’s disease. Alzheimers & Dementia. 2017, 13(7): P229.
This article showed that C3-C3a receptor activation promotes reactive gliosis and tau pathology in PS19 mice through the activation of the Jak-Stat3 pathway and indicates that blocking C3aR can be therapeutically beneficial for AD treatment.
3. Morgan M., et al. Role of complement anaphylatoxin receptors in a mouse model of acute burn-induced pain. Molecular Immunology. 2017, 94: 68-74. PMID: 29274925
This article investigated the role of complement receptors C3aR, C5aR1 and C5aR2 in a mouse model of acute burn-induced pain. The results showed that C3aR, C5aR1, and C5aR2 had a limited role in burn-induced pain in mice.
4. Ajona D., et al. Complement anaphylatoxins C3a and C5a: Emerging roles in cancer progression and treatment. Seminars in Cell & Developmental Biology. 2017. PMID: 29155219
This article summarized the involvement of anaphylatoxins and their receptors in tumor progression and the development of current treatment.
5. Grajales-Esquivel E., et al. Complement component C3aR constitutes a novel regulator for chick eye morphogenesis. Developmental Biology. 2017, 428(1): 88-100. PMID: 28576690
As C3a/C3aR signaling induces chock retina regeneration, this study further analyzed its role in chick eye morphogenesis. The results showed that C3aR was necessary for the proper morphogenesis of the optic cup.
C3AR1 Preparation Options
In vitro studies of membrane proteins are reliant on their successful isolation and reconstitution. Creative Biolabs is active in the areas of membrane protein (receptors, ion channels, transporters, etc) expression, solubilization, stabilization, and purification. We have developed our versatile Magic™ membrane protein platform to express and handle these difficult-to-prepare membrane proteins using specialized techniques and expertise. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-C3AR1 antibody development services.
contact us for more detailed information about our membrane protein preparation services.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
