Introduction of CACNG4
CACNG4 is encoded by CACNG4 gene. It belongs to the neuronal calcium channel gamma subunit subfamily which has been extensively studied during the past few decades because it offers lots of possibilities for therapeutic applications. CACNG4 is one of the five subunits of L-type calcium channels. It regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs).
| Basic Information of CACNG4 | |
| Protein Name | Voltage-dependent calcium channel gamma-4 subunit |
| Gene Name | CACNG4 |
| Aliases | NA |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9UBN1 |
| Transmembrane Times | 4 |
| Length (aa) | 327 |
| Sequence | MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV |
Function of CACNG4 Membrane Protein
CACNG4 is a type I transmembrane AMPA receptor regulatory protein (TARP). It can be discretely expressed in specific neuronal and glial populations and differentially regulate synaptic transmission throughout the brain. CACNG4 can also promote the targets to cell membranes and synapses and regulate its portal control characteristics by slowing down the rate of activation, deactivation, and desensitization. Recent studies show that it may be helpful for acute myocardial infarction therapy. It is documented that CACNG4, enriched in the MAPK signaling pathway, may be involved in cancer evolution and heterogeneity formation.
Fig.1 Structure of the p38 MAPK pathway.
Application of CACNG4 Membrane Protein in Literature
This article reveals the regulation function of DSCR9, a lncRNA transcribed from the Down syndrome critical region (DSCR). These results indicate that most significant pathways, such as the calcium signaling pathway (CACNA1F, CACNG4, HTR4, P2RX2, and SLC8A3), are associated with the top DSCR9 co-expressed genes.
This article analyzes the expression level of differentially expressed genes (DEGs) and studies the early diagnosis of acute myocardial infarction. The data show these genes should be useful for AMI therapy.
Authors in this group examine the expression levels of differentially expressed genes on human squamous cell carcinoma of the bladder (SCCB). The results demonstrate that they are particularly enriched in the MAPK signaling pathways, such as CACNG4, CACNA1E, and CACNA1H, which involve in cancer evolution and heterogeneity formation.
CACNG4 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-CACNG4 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.