Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CACNG4
CACNG4 is encoded by CACNG4 gene. It belongs to the neuronal calcium channel gamma subunit subfamily which has been extensively studied during the past few decades because it offers lots of possibilities for therapeutic applications. CACNG4 is one of the five subunits of L-type calcium channels. It regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs).
| Basic Information of CACNG4 | |
| Protein Name | Voltage-dependent calcium channel gamma-4 subunit |
| Gene Name | CACNG4 |
| Aliases | NA |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9UBN1 |
| Transmembrane Times | 4 |
| Length (aa) | 327 |
| Sequence | MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV |
Function of CACNG4 Membrane Protein
CACNG4 is a type I transmembrane AMPA receptor regulatory protein (TARP). It can be discretely expressed in specific neuronal and glial populations and differentially regulate synaptic transmission throughout the brain. CACNG4 can also promote the targets to cell membranes and synapses and regulate its portal control characteristics by slowing down the rate of activation, deactivation, and desensitization. Recent studies show that it may be helpful for acute myocardial infarction therapy. It is documented that CACNG4, enriched in the MAPK signaling pathway, may be involved in cancer evolution and heterogeneity formation.
Fig.1 Structure of the p38 MAPK pathway.
Application of CACNG4 Membrane Protein in Literature
This article reveals the regulation function of DSCR9, a lncRNA transcribed from the Down syndrome critical region (DSCR). These results indicate that most significant pathways, such as the calcium signaling pathway (CACNA1F, CACNG4, HTR4, P2RX2, and SLC8A3), are associated with the top DSCR9 co-expressed genes.
This article analyzes the expression level of differentially expressed genes (DEGs) and studies the early diagnosis of acute myocardial infarction. The data show these genes should be useful for AMI therapy.
Authors in this group examine the expression levels of differentially expressed genes on human squamous cell carcinoma of the bladder (SCCB). The results demonstrate that they are particularly enriched in the MAPK signaling pathways, such as CACNG4, CACNA1E, and CACNA1H, which involve in cancer evolution and heterogeneity formation.
CACNG4 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CACNG4 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
