Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CCR-7
CCR-7, also known as cluster of differentiation 197 (CD197), EBI1 or BLR2, is a membrane protein encoded by CCR7 gene. It is a member of the G protein-coupled receptor family, and is primarily expressed in various lymphoid tissues and activates B and T lymphocytes. CCR-7 has also been found in various cancer cells, such as nonsmall lung cancer, gastric cancer, and oesophageal cancer. This protein is supposed to be a mediator of Epstein-Barr virus (EBV) effects on B lymphocytes. The ligands of CCR-7 include the chemokines (C-C motif) ligand 19 (CCL19/ELC) and (C-C motif) ligand 21 (CCL21).
| Basic Information of CCR-7 | |
| Protein Name | C-C chemokine receptor type 7 |
| Gene Name | CCR-7 |
| Aliases | BLR2, CD197, EBV-induced G-protein coupled receptor 1, MIP-3 beta receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | P32248 |
| Transmembrane Times | 7 |
| Length (aa) | 378 |
| Sequence |
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICF VGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSF FSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRC SLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYN GVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQE QLRQWSSCRHIRRSSMSVEAETTTTFSP |
Function of CCR-7 Membrane Protein
CCR7 has been demonstrated to be responsible for stimulation of dendritic cell maturation. And it is also involved in the migration of memory T cells to inflamed tissues, trafficking of T cells within the spleen, as well as homing of T cells to various secondary lymphoid organs such as lymph nodes and the spleen. CCR-7 mediated signals play a role in regulating T cell homeostasis in lymph nodes, and may also contribute to the activation and polarization of T cells. Specifically, CCR7 plays a crucial role in coordinating the meeting between mature antigen presenting DCs and naïve T-cells which normally occurs in the lymph nodes (LNs). This process is a precondition for the initiation of an antigen-specific T-cell mediated immune response. Consequently, CCR7 and its ligands are vital actors in initiating cell-based immune responses. Additionally, this receptor also functions in chronic inflammation pathogenesis.
Application of CCR-7 Membrane Protein in Literature
1. Fleige H., et al. Manifold Roles of CCR7 and Its Ligands in the Induction and Maintenance of Bronchus-Associated Lymphoid Tissue. Cell Rep. 2018, 23(3): 783-795. PubMed ID: 29669284
This article provides novel insights into CCR7/CCR7-ligand-orchestrated aspects in bronchus-associated lymphoid tissue (BALT) formation.
2. Uetz-von Allmen E., et al. A unique signal sequence of the chemokine receptor CCR7 promotes package into COPII vesicles for efficient receptor trafficking. Clin Hemorheol Microcirc. 2018, 104(2): 375-389. PubMed ID: 29603364
This article suggests that the chemokine receptor CCR7, which is essential for directed migration of adaptive immune cells, possesses a 24 amino acids long N-terminal signal sequence that is unique among chemokine receptors, and this signal sequence promotes efficient recruitment of the GPCR to ER exit sites, thereby controlling efficient ER to Golgi trafficking of CCR7 on its way to reach the plasma membrane.
3. Maolake A., et al. Tumor necrosis factor-α induces prostate cancer cell migration in lymphatic metastasis through CCR7 upregulation. Cancer Sci. 2018, 109(5): 1524-1531. PubMed ID: 29575464
Authors in this group demonstrated that TNF-α leads to the induction of CCR7 expression and that the CCL21/CCR7 axis might increase the metastatic potential of prostate cancer cells in lymph node metastasis.
4. Belikan P., et al. CCR7 on CD4+ T Cells Plays a Crucial Role in the Induction of Experimental Autoimmune Encephalomyelitis. J Immunol. 2018, 200(8): 2554-2562. PubMed ID: 29549177
Authors of this article indicate a crucial role of CCR7 in neuroinflammation during the priming of autoimmune CD4+ T cells but not in the CNS.
5. Tutunea-Fatan E., et al. The role of CCL21/CCR7 chemokine axis in breast cancer-induced lymphangiogenesis. Am J Transl Res. 2015, 14: 35. PubMed ID: 25744065
This article reveals that CCR7 and VEGF-C display a significant crosstalk and suggest a novel role of the CCL21/CCR7 chemokine axis in the promotion of breast cancer-induced lymphangiogenesis.
CCR-7 Preparation Options
Our fabulous Magic™ membrane protein production platform allows many flexible options, by which you can always find the most appropriate one for your project. We present robust reconstitution forms as well as multiple active formats for membrane proteins to meet your specific requirements. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CCR-7 antibody development services.
With the world’s broadest range of knowledge in membrane protein, Creative Biolabs applies its expertise in professional membrane protein preparation of demanded formats by all sorts of strategies. In complement to our regular membrane protein preparation services, we also offer customized services based on the requirements of our clients. Please feel free to contact us for detailed information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
