Close

CELSR1 Membrane Protein Introduction

Introduction of CELSR1

CELSR1, also known as flamingo homolog 2 (hFmi2) or cadherin family member 9 (CDHF9), is a membrane protein belongs to the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily which is a subpopulation that does not interact with catenins comprise several nonclassic-type cadherins. The flamingo cadherins are located at the plasma membrane and consist of nine cadherin domains, two laminin G-like domains in their ectodomain, and seven epidermal growth factor-like repeats. The unique characteristic of this subfamily is that they have seven transmembrane domains.

Basic Information of CELSR1
Protein Name Cadherin EGF LAG seven-pass G-type receptor 1
Gene Name CELSR1
Aliases Cadherin family member 9, Flamingo homolog 2, hFmi2
Organism Homo sapiens (Human)
UniProt ID Q9NYQ6
Transmembrane Times 7
Length (aa) 3014
Sequence MAPPPPPVLPVLLLLAAAAALPAMGLRAAAWEPRVPGGTRAFALRPGCTYAVGAACTPRAPRELLDVGRD
GRLAGRRRVSGAGRPLPLQVRLVARSAPTALSRRLRARTHLPGCGARARLCGTGARLCGALCFPVPGGCA
AAQHSALAAPTTLPACRCPPRPRPRCPGRPICLPPGGSVRLRLLCALRRAAGAVRVGLALEAATAGTPSA
SPSPSPPLPPNLPEARAGPARRARRGTSGRGSLKFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERV
SYYMEGLFDERSRGYFRIDSATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHS
PVFEQSEYRERVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWDVFQLNESSGVVSTRAVLDREEA
AEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRVQATDRDQGQ
NAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGGRPPLINSSGVVSVQVLDVND
NEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPF
QIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDA
AVGSSVLTLQARDRDANSVITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRS
HTAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRIDPD
SGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPSTS
ILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLS
ASVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLD
LLNGDLRAMVELDFEVRREYVLVVQATSAPLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNSFP
TGVIGCIPAHDPDVSDSLNYTFVQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGIHSVTAF
CTLRVTIITDDMLTNSITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNV
TFSALLPGGVRGQFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVSVLRFDSSAPF
LSSTTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSDPCGANGRCRSREGGYTCECFEDFTGEHCEV
DARSGRCANGVCKNGGTCVNLLIGGFHCVCPPGEYERPYCEVTTRSFPPQSFVTFRGLRQRFHFTISLTF
ATQERNGLLLYNGRFNEKHDFIALEIVDEQVQLTFSAGETTTTVAPKVPSGVSDGRWHSVQVQYYNKPNI
GHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDIGNYSCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDF
PVHNRQFVGCMRNLSVDGKNVDMAGFIANNGTREGCAARRNFCDGRRCQNGGTCVNRWNMYLCECPLRFG
GKNCEQAMPHPQLFSGESVVSWSDLNIIISVPWYLGLMFRTRKEDSVLMEATSGGPTSFRLQILNNYLQF
EVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRS
VVVGGASEDKVSVRRGFRGCMQGVRMGGTPTNVATLNMNNALKVRVKDGCDVDDPCTSSPCPPNSRCHDA
WEDYSCVCDKGYLGINCVDACHLNPCENMGACVRSPGSPQGYVCECGPSHYGPYCENKLDLPCPRGWWGN
PVCGPCHCAVSKGFDPDCNKTNGQCQCKENYYKLLAQDTCLPCDCFPHGSHSRTCDMATGQCACKPGVIG
RQCNRCDNPFAEVTTLGCEVIYNGCPKAFEAGIWWPQTKFGQPAAVPCPKGSVGNAVRHCSGEKGWLPPE
LFNCTTISFVDLRAMNEKLSRNETQVDGARALQLVRALRSATQHTGTLFGNDVRTAYQLLGHVLQHESWQ
QGFDLAATQDADFHEDVIHSGSALLAPATRAAWEQIQRSEGGTAQLLRRLEGYFSNVARNVRRTYLRPFV
IVTANMILAVDIFDKFNFTGARVPRFDTIHEEFPRELESSVSFPADFFRPPEEKEGPLLRPAGRRTTPQT
TRPGPGTEREAPISRRRRHPDDAGQFAVALVIIYRTLGQLLPERYDPDRRSLRLPHRPIINTPMVSTLVY
SEGAPLPRPLERPVLVEFALLEVEERTKPVCVFWNHSLAVGGTGGWSARGCELLSRNRTHVACQCSHTAS
FAVLMDISRRENGEVLPLKIVTYAAVSLSLAALLVAFVLLSLVRMLRSNLHSIHKHLAVALFLSQLVFVI
GINQTENPFLCTVVAILLHYIYMSTFAWTLVESLHVYRMLTEVRNIDTGPMRFYYVVGWGIPAIVTGLAV
GLDPQGYGNPDFCWLSLQDTLIWSFAGPIGAVIIINTVTSVLSAKVSCQRKHHYYGKKGIVSLLRTAFLL
LLLISATWLLGLLAVNRDALSFHYLFAIFSGLQGPFVLLFHCVLNQEVRKHLKGVLGGRKLHLEDSATTR
ATLLTRSLNCNTTFGDGPDMLRTDLGESTASLDSIVRDEGIQKLGVSSGLVRGSHGEPDASLMPRSCKDP
PGHDSDSDSELSLDEQSSSYASSHSSDSEDDGVGAEEKWDPARGAVHSTPKGDAVANHVPAGWPDQSLAE
SDSEDPSGKPRLKVETKVSVELHREEQGSHRGEYPPDQESGGAARLASSQPPEQRKGILKNKVTYPPPLT
LTEQTLKGRLREKLADCEQSPTSSRTSSLGSGGPDCAITVKSPGREPGRDHLNGVAMNVRTGSAQADGSD
SEKP

Function of CELSR1 Membrane Protein

CELSR1 was found to be endogenously expressed in human aortic endothelial cells (HAEC) and human umbilical vein endothelial cells (HUVEC). And it is a pivotal component of the noncanonical Wnt/planar cell polarity (PCP) pathway which critically modulates endothelial cell proliferation and angiogenesis. Thus, CELSR1 is supposed to play a crucial role in regulating multiple phenotypes of endothelial cells, including migration, proliferation, and formation of capillary-like structures. Furthermore, Wnt /PCP signaling pathway is proved to be implicated in human carcinogenesis. Antibody, RNAi, or small molecule compounds that regulate the function of Wnt /PCP signaling molecules, including CELSR1, are potential candidates for novel cancer therapeutics. CELSR1 may also play an essential role in cell-cell signaling during nervous system formation. Specifically, CELSR1 is supposed to be involved in contact-mediated communication, with cadherin domains functioning as homophilic binding regions and the EGF-like domains contributing to cell adhesion and receptor-ligand interactions.

Fig.1 Domain architecture of CELSR1. (Wang, 2014)

Application of CELSR1 Membrane Protein in Literature

1. Duncan J.S., et al. Celsr1 coordinates the planar polarity of vestibular hair cells during inner ear development. Dev Biol. 2017, 423(2): 126-137. PubMed ID: 28159525

This article reports that Celsr1 is asymmetrically distributed at cell boundaries between hair cells and neighboring supporting cells in the developing vestibular and auditory sensory epithelia.

2. Glasco D.M., et al. The atypical cadherin Celsr1 functions non-cell autonomously to block rostral migration of facial branchiomotor neurons in mice. Dev Biol. 2016, 417(1): 40-9. PubMed ID: 27395006

This article suggests strongly that Celsr1 ensures that FBM neurons migrate caudally by suppressing molecular cues in the rostral hindbrain that can attract FBM neurons.

3. Zhan Y.H., et al. CELSR1 Is a Positive Regulator of Endothelial Cell Migration and Angiogenesis. Biochemistry (Mosc). 2016, 81(6): 591-9. PubMed ID: 27301287

Authors in this group evaluate the biological significance of CELSR1 in endothelial cell migration and angiogenesis and show that CELSR1 plays an important role in regulating multiple phenotypes of endothelial cells, including proliferation, migration, and formation of capillary-like structures.

4. Shi D., et al. Celsr1 is required for the generation of polarity at multiple levels of the mouse oviduct. Development. 2014, 141(23): 4558-68. PubMed ID: 2540639

This article focuses on the pharmacological activation of adenosine signaling in β-cell proliferation in zebrafish. It shows that A2a receptor plays an important role in adenosine signaling and compensatory β-cell proliferation. Meanwhile, this feature can be used in future therapeutic development for diabetes.

5. Tatin F., et al. Planar cell polarity protein Celsr1 regulates endothelial adherens junctions and directed cell rearrangements during valve morphogenesis. Dev Cell. 2013, 26(1): 31-44. PubMed ID: 23792146

This article shows a critical role for the core planar cell polarity (PCP) proteins Celsr1 and Vangl2 in the complex morphogenetic process of intraluminal valve formation in lymphatic vessels. PCP signaling controls tissue morphogenesis by coordinating collective cell behaviors.

CELSR1 Preparation Options

The Magic™ membrane protein production platform in Creative Biolabs ensures robust reconstitution forms as well as multiple active formats for membrane proteins. Based on your specific requirements, our experienced scientists are proud to offer customized services with fast turnaround times. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CELSR1 antibody development services.


Creative Biolabs, a leading specialty clinical research organization (CRO), provides state-of-the-art platforms for membrane protein preparation to our clients all over the world. Our Magic™ Platform provides advanced strategies for membrane protein preparation of various requirements. Please feel free to contact us for more information.

Reference

  1. Wang X J., et al. (2014). Understanding cadherin EGF LAG seven-pass G-type receptors. Journal of neurochemistry. 131(6), 699-711.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us