Close

CELSR2 Membrane Protein Introduction

Introduction of CELSR2

CELSR2, encoded by CELSR2 gene, is a member of the flamingo subfamily, one of the cadherin superfamily. The extracellular domain of flamingo cadherins is very large, consist of nine N-terminal repeated cadherin domains, seven epidermal growth factor-like repeats, two laminin A G-type repeats, a hormone receptor motif and a G-protein-coupled receptor proteolytic site. The flamingo cadherins also have seven transmembrane domains which are unique structural feature of the subfamily.

Basic Information of CELSR2
Protein Name Cadherin EGF LAG seven-pass G-type receptor 2
Gene Name CELSR2
Aliases EGFL2, MEGF3, ADGRC2, CDHF10, Flamingo1
Organism Homo sapiens (Human)
UniProt ID Q9HCU4
Transmembrane Times 7
Length (aa) 2923
Sequence MRSPATGVPLPTPPPPLLLLLLLLLPPPLLGDQVGPCRSLGSRGRGSSGACAPMGWLCPS
SASNLWLYTSRCRDAGTELTGHLVPHHDGLRVWCPESEAHIPLPPAPEGCPWSCRLLGIG
GHLSPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQ
FQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPVTGA
VTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRE
NLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGPVDREEV
ESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLR
VTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGG
RPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARL
EYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTV
LDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS
QSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTVN
VNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVS
YTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISAT
DRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQI
VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRNDNP
PVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTG
ELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMSPER
FLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFL
PSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSS
VLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDGYTG
EHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPAHSFITF
RGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVS
PFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGSVLG
NYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRQFVGCMRNLQVDSRHIDMAD
FIANNGTVPGCPAKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMANPQHFL
GSSLVAWHGLSLPISQPWYLSLMFRTRQADGVLLQAITRGRSTITLQLREGHVMLSVEGT
GLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRLHGLHLS
NITVGGIPGPAGGVARGFRGCLQGVRVSDTPEGVNSLDPSHGESINVEQGCSLPDPCDSN
PCPANSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPHGYTCECPPN
YLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPT
CLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAI
EAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSITFSELKGFAERL
QRNESGLDSGRSQQLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESTQRGFGLSATQ
DVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPF
TIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAG
PGEAQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPIINT
PVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCE
VVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFFFLTL
LRILRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLE
ALHLYRALTEVRDVNTGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLI
WSFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLQPSFAVLLLLSATWLLAL
LSVNSDTLLFHYLFATCNCIQGPFIFLSYVVLSKEVRKALKLACSRKPSPDPALTTKSTL
TSSYNCPSPYADGRLYQPYGDSAGSLHSTSRSGKSQPSYIPFLLREESALNPGQGPPGLG
DPGSLFLEGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEEEEEAAFPGEQG
WDSLLGPGAERLPLHSTPKDGGPGPGKAPWPGDFGTTAKESSGNGAPEERLRENGDALSR
EGSLGPLPGSSAQPHKGILKKKCLPTISEKSSLLRLPLEQCTGSSRGSSASEGSRGGPPP
RPPPRQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH

Function of CELSR2 Membrane Protein

CELSR2 plays an essential role in the contact-mediated communication, involving in cell adhesion and receptor-ligand interactions. Studies have been shown that CELSR2 is involved in the development of nervous system through regulating neural migration, axon guidance, and cilium polarity. During the development of brain, CELSR2 regulates ciliogenesis via PCP signaling. In mice, CELSR2 knockout and CELSR2/ CELSR3 double-knockout impair the development of ependymal cilia and give rise to the fatal hydrocephalus. Moreover, CELSR2 also functions as a mediator in glucose homeostasis. In mice, the deficiency of CELSR2/3 could reduce the pancreatic β cells differentiation, leading to a decreased glucose eliminate. Besides, some variants of CELSR2 in humans are associated with the low-density lipoprotein and higher high-density lipoprotein cholesterol levels, implicating the functions of CELSR2 in the coronary artery disease (CAD) and ischemic stroke. Additionally, CELSR2 is also involved in the progress of breast cancer.

CELSR2 Membrane Protein IntroductionFig.1 Cadherin mediates the cell-cell adhesion.

Application of CELSR2 Membrane Protein in Literature

1. Jiang L., et al. Differential cellular localization of CELSR2 and ING4 and correlations with hormone receptor status in breast cancer. Histology & Histopathology. 2018, 33(8): 835-842. PMID: 29489009

Jiang’s study analyzes the expression of CELSR2 and ING4 protein in breast tumors and benign epithelial cells by means of Immunohistochemistry. And the result showed that both CELSR2 and ING4 cytoplasmic expression was significantly stronger in breast cancer cells than in benign epithelial cells, which suggests the two genes may play important roles in the pathogenesis of human breast cancer.

2. Einarsdottir E., et al. CELSR2 is a candidate susceptibility gene in idiopathic scoliosis. Plos One. 2017, 12(12): e0189591. PubMed ID: 29240829

This study reveals that a rare variant in CELSR2 is found as causative for idiopathic scoliosis in a family with dominant segregation. Moreover, the common variations in the highly conserved GAIN protein domain of CELSR2 are susceptible factors for idiopathic scoliosis in the Swedish-Danish population.

3. Vilboux T., et al. CELSR2, encoding a planar cell polarity protein, is a putative gene in Joubert syndrome with cortical heterotopia, microophthalmia, and growth hormone deficiency. American Journal of Medical Genetics Part A. 2017, 173(3): 661-666. PMID: 28052552

CELSR2, a planar cell polarity protein, plays an important role in neural development. The study reports that the bi-allelic mutations in CELSR2 in Joubert syndrome with cortical heterotopia, microophthalmia, and growth hormone deficiency.

4. Zhou Y J., et al. Association of variants in CELSR2-PSRC1-SORT1 with risk of serum lipid traits, coronary artery disease and ischemic stroke. International Journal of Clinical & Experimental Pathology. 2015, 8(8): 9543-51. PMID: 26464717

The study suggests that the minor G alleles of rs599839 and rs464218 SNPs are significantly associated with higher high-density lipoprotein cholesterol concentrations in the southern Chinese patients with coronary artery disease (CAD) and ischemic stroke (IS). However, the SNPs of rs599839, rs464218, and rs6698843 at the CELSR2-PSRC1-SORT1 are not related to the risk of CAD or IS.

5. Qu Y., et al. Genetic evidence that Celsr3 and Celsr2, together with Fzd3, regulate forebrain wiring in a Vangl-independent manner. Proceedings of the National Academy of Sciences of the United States of America. 2014, 111(29): E2996. PMID: 25002511

The study shows that Celsr2 and Celsr 3, as well as Fzd3, regulate axon guidance in the forebrain in an independent manner. The mechanism is different from classical epithelial PCP signaling mediation.

CELSR2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CELSR2 antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane proteins, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us