Close

CELSR3 Membrane Protein Introduction

Introduction of CELSR3

CELSR3, encoded by CELSR3 gene, is a member of the flamingo subfamily, one of the cadherin superfamily. The flamingo cadherins belong to nonclassic-type cadherins that do not interact with catenins. The ectodomain of flamingo cadherin contains seven epidermal growth factor-like repeats, nine cadherin domains and two laminin A G-type repeats. Besides, it also has seven transmembrane domains which are characteristic feature of their subfamily.

Basic Information of CELSR3
Protein Name Cadherin EGF LAG seven-pass G-type receptor 3
Gene Name CELSR3
Aliases FMI1, EGFL1, HFMI1, MEGF2, ADGRC3, CDHF11, RESDA1
Organism Homo sapiens (Human)
UniProt ID Q9NYQ7
Transmembrane Times 7
Length (aa) 3312
Sequence MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGPRAHIGGGA
LALCPESSGVREDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGS
RERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
GPKPVSSQRNAGTGSRKRVGTARCCGELWATGSKGQGERATTSGAERTAPRRNCLPGASG
SGPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSRGLFRCRFLPQRPGPRPPGLPA
RPEARKVTSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRL
VYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARA
AAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDEND
NAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTG
EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSV
LENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVE
HYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA
VDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDN
LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ
FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR
TVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENS
IVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVI
VVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP
DVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV
LRVVIITEELLANSLTVRLENMWQERFLSPLLGRFLEGVAAVLATPAEDVFIFNIQNDTD
VGGTVLNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCL
REPCENYMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCY
SNPCRNGGACARREGGYTCVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCTDAPNGGFRC
QCPAGGAFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQQSGLLFYNGRLNE
KHDFLALELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLRYYNKPRTDALGGAQ
GPSKDKVAVLSVDDCDVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLP
ENFPVSHKDFIGCMRDLHIDGRRVDMAAFVANNGTMAGCQAKLHFCDSGPCKNSGFCSER
WGSFSCDCPVGFGGKDCQLTMAHPHHFRGNGTLSWNFGSDMAVSVPWYLGLAFRTRATQG
VLMQVQAGPHSTLLCQLDRGLLSVTVTRGSGRASHLLLDQVTVSDGRWHDLRLELQEEPG
GRRGHHVLMVSLDFSLFQDTMAVGSELQGLKVKQLHVGGLPPGSAEEAPQGLVGCIQGVW
LGSTPSGSPALLPPSHRVNAEPGCVVTNACASGPCPPHADCRDLWQTFSCTCQPGYYGPG
CVDACLLNPCQNQGSCRHLPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPC
NCDVHKGFDPNCNKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRP
GALGRQCNSCDSPFAEVTASGCRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGAA
VRLCDEAQGWLEPDLFNCTSPAFRELSLLLDGLELNKTALDTMEAKKLAQRLREVTGHTD
HYFSQDVRVTARLLAHLLAFESHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAAL
GQRAPGGSPGSAGLVRHLEEYAATLARNMELTYLNPMGLVTPNIMLSIDRMEHPSSPRGA
RRYPRYHSNLFRGQDAWDPHTHVLLPSQSPRPSPSEVLPTSSSIENSTTSSVVPPPAPPE
PEPGISIIILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGILE
SPISLEFRLLQTANRSKAICVQWDPPGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTF
GVLMDASPRERLEGDLELLAVFTHVVVAVSVAALVLTAAILLSLRSLKSNVRGIHANVAA
ALGVAELLFLLGIHRTHNQLVCTAVAILLHYFFLSTFAWLFVQGLHLYRMQVEPRNVDRG
AMRFYHALGWGVPAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPVVLVIVMNGTM
FLLAARTSCSTGQREAKKTSALTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLC
GLQGLAVLLLFCVLNADARAAWMPACLGRKAAPEEARPAPGLGPGAYNNTALFEESGLIR
ITLGASTVSSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLD
VAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLCRAAQSERLLTHP
KDVDGNDLLSYWPALGECEAAPCALQTWGSERRLGLDTSKDAANNNQPDPALTSGDETSL
GRAQRQRKGILKNRLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLS
QPASRYSSREQLDLLLRRQLSRERLEEAPAPVLRPLSRPGSQECMDAAPGRLEPKDRGST
LPRRQPPRDYPGAMAGRFGSRDALDLGAPREWLSTLPPPRRTRDLDPQPPPLPLSPQRQL
SRDPLLPSRPLDSLSRSSNSREQLDQVPSRHPSREALGPLPQLLRAREDSVSGPSHGPST
EQLDILSSILASFNSSALSSVQSSSTPLGPHTTATPSATASVLGPSTPRSATSHSISELS
PDSEVPRSEGHS

Function of CELSR3 Membrane Protein

CELSR3 may function as a regulator of nervous system development. It can regulate the contact-dependent neurite growth and ependymal ciliogenesis through the planar cell polarity (PCP) signaling. The deficiency of CELSR3 and CELSR1 may significantly suppress the ependyma ciliogenesis and lead to lethal hydrocephalus. Moreover, CELSR3 together with Fzd3 participate in the regulation of the development of most longitudinal tracts in the central nervous system. And they also mediate axon guidance in the peripheral, sympathetic and enteric nervous systems. The study showed that Celsr3 and Fzd3 regulate the formation of a scaffold of pioneer neurons and their axons which control growing thalamocortical axons. In addition, CELSR3 may involve in tumor formation. The studies have been shown that CELSR3 moter hypermethylation is associated with the progress of oral squamous cell carcinoma. And CELSR3 has selectively up-regulated in tumor stellate cells.

CELSR3 Membrane Protein IntroductionFig.1 G protein-coupled receptors.

Application of CELSR3 Membrane Protein in Literature

1. Chen Z., et al. Genetic analysis of Wnt/PCP genes in neural tube defects. Bmc Medical Genomics. 2018, 11(1): 38. PMID: 29618362

The study is designed to analyze Wnt/PCP genes in Chinese and Caucasian neural tube defects (NTD). The result shows that CELSR1, CELSR2, and CELSR3 genes were significantly clustered along with rare driver coding mutations. And compound heterozygote variants of CELSR2 p.Thr2026Met and DVL3 p.Asp403Asn could down-regulate PCP signals.

2. Wang F., et al. The role of Celsr3 in the development of central somatosensory projections from dorsal root ganglia. Neuroscience. 2017, 359: 267-76. PMID: 28754314

The study is to explore the function of CELSR3 in dorsal root ganglion (DRG) neurons using conditional gene inactivation in crosses with Wnt1-Cre mice. The result shows that CELSR3 is not a necessary factor for the patterning of central DRG projections, but it plays an important role in the mediation of central somatosensory projections development from dorsal root ganglia.

3. Khor G H., et al. Involvement of CELSR3 Hypermethylation in Primary Oral Squamous Cell Carcinoma. Asian Pacific Journal of Cancer Prevention Apjcp. 2016, 17(1): 219-23. PMID: 26838213

The study shows that a high methylation level of CELSR3 is detected in 86% of oral squamous cell carcinomas patients. And CELSR3 quantitative methylation levels are markedly associated with patient ethnicity.

4. Su L., et al. Deregulation of the planar cell polarity genes CELSR3 and FZD3 in Hirschsprung disease. Experimental & Molecular Pathology. 2016, 101(2): 241-8. PMID: 27619161

Su’s study reveals that the down-regulated expression of CELSR3 and FZD3, the planar cell polarity genes may obstruct the enteric innervation pattern, consequently resulting in the risk of Hirschsprung disease (HSCR).

5. Karpathakis A., et al. Prognostic Impact of Novel Molecular Subtypes of Small Intestinal Neuroendocrine Tumor. Clinical Cancer Research. 2016, 22(1): 250-8. PMID: 26169971

The study is the first comprehensive integrated molecular analysis of small intestinal neuroendocrine tumors (SINETs). Results show that SINETs are highly epigenetically dysregulated. And 21 epigenetically dysregulated genes were identified, including CDX1 (86%), CELSR3 (84%), FBP1 (84%), and GIPR (74%).

CELSR3 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CELSR3 antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us