Close

CLDN4 Membrane Protein Introduction

Introduction of CLDN4

Claudin 4 (CLDN4) belongs to the group of claudins. It is a protein which is encoded by the CLDN4 gene in humans. An important paralog of this gene is CLDN3. Claudins are integral membrane proteins which are components of the epithelial cell tight junctions. It regulates the movement of ions and solutes through the paracellular space. Claudin 4 protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE). It may play a role in the development and function of internal organs during pre- and postnatal life. Related pathways include blood-brain barrier and immune cell transmigration: VCAM-1/CD106 signaling pathways and circadian rythm related genes. Gene Ontology (GO) annotations related to this gene include identical protein binding and structural molecule activity.

Basic Information of CLDN4
Protein Name Claudin-4
Gene Name CLDN4
Aliases Clostridium perfringens enterotoxin receptor, CPE-R, CPE-receptor, Williams-Beuren syndrome chromosomal region 8 protein, CPER, CPETR1, WBSCR8
Organism Homo sapiens (Human)
UniProt ID O14493
Transmembrane Times 4
Length (aa) 209
Sequence MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Function of CLDN4 Membrane Protein

Claudins play key roles in the tight junction-specific occlusion of the intercellular space by calcium-dependent cell adhesion activity. CLDN4 mediates paracellular chloride transport in the kidney by forming a tight junction protein of the channel. In addition, CLDN4 plays a critical role in the paracellular reabsorption of chloride in the kidney collection ducts. Several diseases are associated with CLDN4, including Gastric Adenocarcinoma and Williams-Beuren Syndrome. Besides, claudin-4 is up-regulated in several types of cancers, such as gastric cancer, spiradenoma and ovarian small cell carcinomas. It is associated with the progress and poor prognosis of cancers.

Fig.1 SMARCB1-deficient sarcomas occasionally positive for claudin-4. (Radulescu, 2013)

Application of CLDN4 Membrane Protein in Literature

  1. Song Y.X., et al. Non-coding RNAs participate in the regulatory network of CLDN4 via ceRNA mediated miRNA evasion. Nat Commun. 2017, 8(1): 289. PubMed ID: 28819095

    Authors in this group have discovered a network regulating claudin-4 in gastric cancer. Claudin-4 is up-regulated in gastric cancer and is associated with poor prognosis and claudin-4 expression is reduced by specific miRNAs.

  2. Molina-Jijón E., et al. Aldosterone signaling regulates the over-expression of claudin-4 and -8 at the distal nephron from type 1 diabetic rats. PLoS One. 2017, 12(5): e0177362. PubMed ID: 28493961

    This article focuses on the effects of aldosterone and spironolactone on the expressions of claudin-2, -4, -5 and -8.

  3. Schaefer I.M., et al. Claudin-4 expression distinguishes SWI/SNF complex-deficient undifferentiated carcinomas from sarcomas. Mod Pathol. 2016, 30(4): 539-548. PubMed ID: 28084340

    The article indicates that the lack of claudin-4 expression in hypercalcemic type ovarian small cell carcinomas is more helpful in diagnosis.

  4. Yiğit N., et al. Distinctive immunostaining of claudin-4 in spiradenomas. Ann Diagn Pathol. 2016, 20: 44-7. PubMed ID: 26616722

    The article reveals that claudin-4 is expressed selectively and distinctly in the ductal-type cells of all cases of spiradenomas. Claudin-4 may be helpful in the diagnosis of spiradenoma.

  5. Liu J.X., et al. Prognostic and clinical significance of claudin-4 in gastric cancer: a meta-analysis. World J Surg Oncol. 2015, 13: 207. PubMed ID: 26109060

    This article reports that overexpression of claudin-4 may be associated with the progress of gastric cancer and poor prognosis of gastric cancer patients.

CLDN4 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-CLDN4 antibody development services.


As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and helps you with the research of membrane proteins. Please do not hesitate to inquire us for more details.

Reference

  1. Hicks D A, et al. (2016). Claudin-4 activity in ovarian tumor cell apoptosis resistance and migration. BMC Cancer. 16(1), 788.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us