Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CLDN4
Claudin 4 (CLDN4) belongs to the group of claudins. It is a protein which is encoded by the CLDN4 gene in humans. An important paralog of this gene is CLDN3. Claudins are integral membrane proteins which are components of the epithelial cell tight junctions. It regulates the movement of ions and solutes through the paracellular space. Claudin 4 protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE). It may play a role in the development and function of internal organs during pre- and postnatal life. Related pathways include blood-brain barrier and immune cell transmigration: VCAM-1/CD106 signaling pathways and circadian rythm related genes. Gene Ontology (GO) annotations related to this gene include identical protein binding and structural molecule activity.
| Basic Information of CLDN4 | |
| Protein Name | Claudin-4 |
| Gene Name | CLDN4 |
| Aliases | Clostridium perfringens enterotoxin receptor, CPE-R, CPE-receptor, Williams-Beuren syndrome chromosomal region 8 protein, CPER, CPETR1, WBSCR8 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O14493 |
| Transmembrane Times | 4 |
| Length (aa) | 209 |
| Sequence | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
Function of CLDN4 Membrane Protein
Claudins play key roles in the tight junction-specific occlusion of the intercellular space by calcium-dependent cell adhesion activity. CLDN4 mediates paracellular chloride transport in the kidney by forming a tight junction protein of the channel. In addition, CLDN4 plays a critical role in the paracellular reabsorption of chloride in the kidney collection ducts. Several diseases are associated with CLDN4, including Gastric Adenocarcinoma and Williams-Beuren Syndrome. Besides, claudin-4 is up-regulated in several types of cancers, such as gastric cancer, spiradenoma and ovarian small cell carcinomas. It is associated with the progress and poor prognosis of cancers.
Fig.1 SMARCB1-deficient sarcomas occasionally positive for claudin-4. (Radulescu, 2013)
Application of CLDN4 Membrane Protein in Literature
Authors in this group have discovered a network regulating claudin-4 in gastric cancer. Claudin-4 is up-regulated in gastric cancer and is associated with poor prognosis and claudin-4 expression is reduced by specific miRNAs.
This article focuses on the effects of aldosterone and spironolactone on the expressions of claudin-2, -4, -5 and -8.
The article indicates that the lack of claudin-4 expression in hypercalcemic type ovarian small cell carcinomas is more helpful in diagnosis.
The article reveals that claudin-4 is expressed selectively and distinctly in the ductal-type cells of all cases of spiradenomas. Claudin-4 may be helpful in the diagnosis of spiradenoma.
This article reports that overexpression of claudin-4 may be associated with the progress of gastric cancer and poor prognosis of gastric cancer patients.
CLDN4 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CLDN4 antibody development services.
As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and helps you with the research of membrane proteins. Please do not hesitate to inquire us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
