Rabbit Anti-Human Complement Factor P Polyclonal Antibody(Cat#: CTA-394)
This product is an unconjugated anti-Human Complement Factor P Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
Synthetic peptides corresponding to CFP (complement factor properdin) The peptide sequence was selected from the N terminal of CFP. Peptide sequence QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS. |
| Species Reactivity |
Human |
| Applications |
WB; IHC |
| Application Notes |
WB: 1:100-1:2000
IHC: 1:10-1:500
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human complement Factor P. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
20; 100 µL |
| Storage |
Store at -20°C. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
Factor P |
| Alternative Names |
Complement Factor Properdin; Properdin P Factor, Complement; Complement Factor P; PFC; PROPERDIN; Properdin; BFD; PFD |
| Gene ID |
5199 |
| UniProt ID |
P27918 |
Information
| Introduction |
Properdin is the only known positive regulator of complement activation that stabilizes the alternative pathway convertases. It is found in the blood serum of more complex animals. Properdin is a gamma globulin protein composed of multiple identical protein subunits with a separate ligand-binding site. It is known that it participates in some specific immune responses. It plays a part in tissue inflammation as well as the engulfing of pathogens by phagocytes. In addition it is known to help to neutralize some viruses. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
