Rabbit Anti-Human Complement Factor P Polyclonal Antibody(Cat#: CTA-394)

This product is an unconjugated anti-Human Complement Factor P Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen Synthetic peptides corresponding to CFP (complement factor properdin) The peptide sequence was selected from the N terminal of CFP. Peptide sequence QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS.
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 1:100-1:2000
IHC: 1:10-1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement Factor P.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 20; 100 µL
Storage Store at -20°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name Factor P
Alternative Names Complement Factor Properdin; Properdin P Factor, Complement; Complement Factor P; PFC; PROPERDIN; Properdin; BFD; PFD
Gene ID 5199
UniProt ID P27918
Information
Introduction Properdin is the only known positive regulator of complement activation that stabilizes the alternative pathway convertases. It is found in the blood serum of more complex animals. Properdin is a gamma globulin protein composed of multiple identical protein subunits with a separate ligand-binding site. It is known that it participates in some specific immune responses. It plays a part in tissue inflammation as well as the engulfing of pathogens by phagocytes. In addition it is known to help to neutralize some viruses.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry