Rabbit Anti-Human Ficolin-1 Polyclonal Antibody-CTA-1055(Cat#: CTA-1055)

This product is an unconjugated anti-Human Ficolin-1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB, IHC.

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen Recombinant human Ficolin-1, aa.: LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 0.04-0.4 μg/mL
IHC: 1:200-1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human Ficolin-1.
Purity ≥95% as determined by SDS-PAGE
Conjugation Unconjugated
Format Liquid
Size 25; 100 µL
Storage Store at 4°C for short term. Store at -20°C for long term. Avoid freeze-thaw cycle.
Type Primary Antibody
Target
Target Name Ficolin-1
Alternative Names Ficolin 1; FCNM ; Ficolin-Alpha; Ficolin-1; M-Ficolin; Ficolin-A; Ficolin (Collagen/Fibrinogen Domain Containing) 1; FCN1
Gene ID 2219
UniProt ID O00602
Information
Introduction Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8. Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry