This product is an unconjugated anti-Human Ficolin-1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB, IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Rabbit |
| Isotype | IgG |
| Immunogen | Recombinant human Ficolin-1, aa.: LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD |
| Species Reactivity | Human |
| Applications | WB; IHC |
| Application Notes | WB: 0.04-0.4 μg/mL IHC: 1:200-1:500 The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human Ficolin-1. |
| Purity | ≥95% as determined by SDS-PAGE |
| Conjugation | Unconjugated |
| Format | Liquid |
| Size | 25; 100 µL |
| Storage | Store at 4°C for short term. Store at -20°C for long term. Avoid freeze-thaw cycle. |
| Type | Primary Antibody |
| Target Name | Ficolin-1 |
| Alternative Names | Ficolin 1; FCNM ; Ficolin-Alpha; Ficolin-1; M-Ficolin; Ficolin-A; Ficolin (Collagen/Fibrinogen Domain Containing) 1; FCN1 |
| Gene ID | 2219 |
| UniProt ID | O00602 |
| Introduction | Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8. Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage. |