Close

CRHR1 Membrane Protein Introduction

Introduction of CRHR1

CRHR1, encoded by CRHR1 gene, also known as CRF1, is a cell-surface protein. It belongs to G-protein coupled receptor family which has seven transmembrane domains. The extracellular domain of receptor responds to peptide hormones, corticotropin-releasing hormone (CRH) and urocortin (UCN), involved in the regulation of response to stress. Most studies have been designed to investigate the CRHR1 possible role in regulation response to stress and in potential drug targets for depression and anxiety.

Basic Information of CRHR1
Protein Name Corticotropin-releasing factor receptor 1
Gene Name CRHR1
Aliases CRF1, CRHR, CRF-R, CRFR1, CRF-R1, CRFR-1, CRH-R1, CRHR1L,
CRF-R-1, CRH-R-1
Organism Homo sapiens (Human)
UniProt ID P34998
Transmembrane Times 7
Length (aa) 444
Sequence MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV

Function of CRHR1 Membrane Protein

CRHR1 binds to its ligands, neuropeptides of the corticotropin-releasing hormone family which are a major regulator of the hypothalamic-pituitary-adrenal pathway (HPA). Moreover, HPA is an important part of the neuroendocrine system, involved in controlling the reaction of stress and regulating many physical activities, such as the digestive system, immune system, mood and emotions, sexuality, as well as the energy storage and consumption. Besides, the binding of CRH and CRHR1 can also promote the activation of the receptors, and activate adenylyl cyclase signaling pathway, resulting in an increase of intracellular second messenger cAMP levels. The signal can be transmitted along multiple signal transduction cascades, such as PKC and MAPK. Most studies have indicated that the CRHR1 is very essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response, and obesity. Mice lacking the CRHR1 impaire stress response and display a reduced anxiety-like and cognitive performance. These also suggest that CRHR1 can be considered as a drug target for depression and anxiety.

The structure of CRHR1. Fig.1 The structure of CRHR1.

Application of CRHR1 Membrane Protein in Literature

  1. Roy A., et al. Family environment interacts with CRHR1 rs17689918 to predict mental health and behavioral outcomes. Progress in neuro-psychopharmacology & biological psychiatry. 2018, 86: 45-51. PubMed ID: 29772307

    The study assesses the effect of SNP rs17689918 in CRHR1 interaction with the environment on behavioral and mental health. Results indicate that male A-allele carriers and female GG homozygotes can present low familial warmth with aggression, higher number of stressful life events with aggression, and stressful life events with anxious-depressive symptoms.

  2. Schartner C., et al. CRHR1 promoter hypomethylation: An epigenetic readout of panic disorder? European Neuropsychopharmacology the Journal of the European College of Neuropsychopharmacology. 2017, 27(4): 360-371. PubMed ID: 28233670

    The study implicates that CRHR1 methylation is significantly decreased in panic disorder patients and in healthy person with high Beck Anxiety Inventory (BAI) scores. Moreover, CRHR1 hypomethylation can upregulate the CRHR1 gene expression. These suggest the upregulated CRHR1 gene expression regulated by hypomethylation may be associated with stress response and panic disorder risk.

  3. Chen H., et al. Activation of corticotropin-releasing factor receptor 1 aggravates dextran sodium sulphate-induced colitis in mice by promoting M1 macrophage polarization. Molecular Medicine Reports. 2018, 17(1): 234-242. PubMed ID: 29115460

    The research aims to investigate the role of CRF-R1 in the development of mucosal inflammation induced by dextran sulphate sodium (DSS). Results show that the CRF-R1 levels are associated with the severity of DSS-induced colitis. These also suggest that CRF-R1 may act as a pro-inflammatory role in the DSS-induced colitis.

  4. Alderman S L., et al. Corticotropin-releasing factor regulates caspase-3 and may protect developing zebrafish from stress-induced apoptosis. General and Comparative Endocrinology. 2018, 265: 207-213. PubMed ID: 29807032

    This study identifies the corticotropin-releasing factor (CRF) role in the regulation of stress-induced apoptosis in a vertebrate model species. CRF regulates caspase-3 activity through a CRF-R1-dependent pathway and protects zebrafish from stress-induced apoptosis.

  5. Grimm S., et al. The Interaction of Corticotropin-Releasing Hormone Receptor Gene and Early Life Stress on Emotional Empathy. Behavioural Brain Research. 2017, 329: 180-185. PubMed ID: 28461011

    The research reveals that CRHR1 polymorphisms are associated with the regulation of the effect of early life stress (ELS) on emotional empathy. And adults with a vulnerable genotype may impair emotional empathy when they are exposed to ELS.

CRHR1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CRHR1 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us