Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CRHR2
CRHR2, encoded by CRHR2 gene, also known as CRF2, is a cell-surface protein. It belongs to G-protein coupled receptor family which has seven transmembrane domains. The extracellular domain of receptor responds to peptide hormones, corticotropin-releasing hormone (CRH) and urocortin (UCN), involved in the regulation of response to stress. Most studies have been designed to investigate the CRHR2 possible role in regulating social behavior response to stress.
| Basic Information of CRHR2 | |
| Protein Name | Corticotropin-releasing factor receptor 2 |
| Gene Name | CRHR2 |
| Aliases | CRF2, CRFR2, CRF-RB, HM-CRF |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q13324 |
| Transmembrane Times | 7 |
| Length (aa) | 438 |
| Sequence |
MRGPSGPPGLLYVPHLLLCLLCLLPPPLQYAAGQSQMPKDQPLWALLEQYCHTIMTLTNL SGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKI NYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNVIHW NLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAI VMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPII LVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGED DLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSI PTSPTRISFHSIKQTAAV |
Function of CRHR2 Membrane Protein
CRHR2 is a receptor for corticotropin-releasing hormone (CRH) and CRH-related peptides such as urocortin. When the receptors bind to its ligands, it will promote the activation of adenylate cyclase, resulting in an intracellular second messenger cAMP levels which activate protein kinase A (PKA) signaling. The results showed that CRHR2 may play a role in the integration of neuroendocrine, autonomic, and behavioral functions. And the deficiency of CRHR2 in mice may present anxiety-like behavior, hypersensitivity to stress, altered feeding behavior and metabolism, and cardiovascular abnormalities. Moreover, CRHR2 may be associated with the pathogenesis of ischemia/reperfusion-induced enteritis, heart failure, irritable bowel syndrome. And a recent study has been shown that CRHR2 antagonist may be used as a promising therapeutic drug to treat chronic heart failure. In addition, CRHR2 is also involved in the pathological processes of cancer. CRF2-signaling can regulate cellular adhesion of human colon cancer cells. And the CRF2 expression in deep infiltrating endometriotic lesions is significantly higher than in ovarian endometrioma.
Fig.1 Corticotropin-releasing hormone signaling pathway.
Application of CRHR2 Membrane Protein in Literature
The study reveals that lacking CRF2 receptor reduces social behaviour deficits and vulnerability induced by cocaine withdrawal. These suggest a new therapeutic target for stimulant use disorders.
This research implicates that CRF2 signaling could regulate intestinal epithelial cell (IEC) differentiation. The mechanisms could be associated with the stress-induced epithelial alterations found in inflammatory bowel diseases.
The research finds that CRF2 is widely expressed in the cardiomyocytes. In mice, continuous infusion of the CRHR2 agonist, urocortin 2 (Ucn2), could reduce left ventricular ejection fraction and lacking CRHR2 could escape from cardiac dysfunction induced by overpressure. These suggest that CRHR2 agonist is a promising drug for chronic heart failure.
The study reveals that identifies a new intracellular circuit involving mAchR acting on CRF2-signaling that could mediate colonic mucosal barrier dysfunction and exacerbate mucosal inflammation.
The study implicates that activated CRF1 receptor regulates the preference for social novelty by CRF and UCN 1. While selectively activated CRF2 receptor by UCN2 and UCN3 doesn't participate in the male-female interaction.
CRHR2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CRHR2 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
