Close

CRHR2 Membrane Protein Introduction

Introduction of CRHR2

CRHR2, encoded by CRHR2 gene, also known as CRF2, is a cell-surface protein. It belongs to G-protein coupled receptor family which has seven transmembrane domains. The extracellular domain of receptor responds to peptide hormones, corticotropin-releasing hormone (CRH) and urocortin (UCN), involved in the regulation of response to stress. Most studies have been designed to investigate the CRHR2 possible role in regulating social behavior response to stress.

Basic Information of CRHR2
Protein Name Corticotropin-releasing factor receptor 2
Gene Name CRHR2
Aliases CRF2, CRFR2, CRF-RB, HM-CRF
Organism Homo sapiens (Human)
UniProt ID Q13324
Transmembrane Times 7
Length (aa) 438
Sequence MRGPSGPPGLLYVPHLLLCLLCLLPPPLQYAAGQSQMPKDQPLWALLEQYCHTIMTLTNL
SGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKI
NYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNVIHW
NLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAI
VMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPII
LVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGED
DLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSI
PTSPTRISFHSIKQTAAV

Function of CRHR2 Membrane Protein

CRHR2 is a receptor for corticotropin-releasing hormone (CRH) and CRH-related peptides such as urocortin. When the receptors bind to its ligands, it will promote the activation of adenylate cyclase, resulting in an intracellular second messenger cAMP levels which activate protein kinase A (PKA) signaling. The results showed that CRHR2 may play a role in the integration of neuroendocrine, autonomic, and behavioral functions. And the deficiency of CRHR2 in mice may present anxiety-like behavior, hypersensitivity to stress, altered feeding behavior and metabolism, and cardiovascular abnormalities. Moreover, CRHR2 may be associated with the pathogenesis of ischemia/reperfusion-induced enteritis, heart failure, irritable bowel syndrome. And a recent study has been shown that CRHR2 antagonist may be used as a promising therapeutic drug to treat chronic heart failure. In addition, CRHR2 is also involved in the pathological processes of cancer. CRF2-signaling can regulate cellular adhesion of human colon cancer cells. And the CRF2 expression in deep infiltrating endometriotic lesions is significantly higher than in ovarian endometrioma.

Corticotropin-releasing hormone signaling pathway. Fig.1 Corticotropin-releasing hormone signaling pathway.

Application of CRHR2 Membrane Protein in Literature

  1. Morisot N., et al. CRF2 receptor-deficiency eliminates social behaviour deficits and vulnerability induced by cocaine. British Journal of Pharmacology. 2018, 175(9): 1504-1518. PubMed ID: 29406581

    The study reveals that lacking CRF2 receptor reduces social behaviour deficits and vulnerability induced by cocaine withdrawal. These suggest a new therapeutic target for stimulant use disorders.

  2. Ducarouge B., et al. Involvement of CRF2 signaling in enterocyte differentiation. World Journal of Gastroenterology. 2017, 23(28): 5127-5145. PubMed ID: 28811708

    This research implicates that CRF2 signaling could regulate intestinal epithelial cell (IEC) differentiation. The mechanisms could be associated with the stress-induced epithelial alterations found in inflammatory bowel diseases.

  3. Tsuda T., et al. Corticotropin releasing hormone receptor 2 exacerbates chronic cardiac dysfunction. Journal of Experimental Medicine. 2017, 214(7): 1877-1888. PubMed ID: 28550160

    The research finds that CRF2 is widely expressed in the cardiomyocytes. In mice, continuous infusion of the CRHR2 agonist, urocortin 2 (Ucn2), could reduce left ventricular ejection fraction and lacking CRHR2 could escape from cardiac dysfunction induced by overpressure. These suggest that CRHR2 agonist is a promising drug for chronic heart failure.

  4. Pelissierrota M., et al. A crosstalk between muscarinic and CRF2 receptors regulates cellular adhesion properties of human colon cancer cells. Biochim Biophys Acta. 2017, 1864(7): 1246-1259. PubMed ID: 28432022

    The study reveals that identifies a new intracellular circuit involving mAchR acting on CRF2-signaling that could mediate colonic mucosal barrier dysfunction and exacerbate mucosal inflammation.

  5. Bagosi Z., et al. The effects of CRF and urocortins on the preference for social novelty of mice. Behavioural Brain Research. 2017, 324: 146-154. PubMed ID: 28189757

    The study implicates that activated CRF1 receptor regulates the preference for social novelty by CRF and UCN 1. While selectively activated CRF2 receptor by UCN2 and UCN3 doesn't participate in the male-female interaction.

CRHR2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CRHR2 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us