Close

CXCR2 Membrane Protein Introduction

Introduction of CXCR2

CXCR2, also known as Interleukin 8 receptor, belongs to a subfamily of chemokine receptors from a large family of G protein-coupled receptor, encoded by CXCR2 gene. It is one of seven CXC chemokine receptors (CXCR1-CXCR7) in mammals. The receptors can recognize CXC chemokine that possesses an E-L-R amino acid motif. Recently, most studies have been made to investigate the CXCR2 role in the treatment of cancer.

Basic Information of CXCR2
Protein Name C-X-C chemokine receptor type 2
Gene Name CXCR2
Aliases CD182, IL8R2, IL8RA, IL8RB, CMKAR2, CDw128b
Organism Homo sapiens (Human)
UniProt ID P25025
Transmembrane Times 7
Length (aa) 360
Sequence MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Function of CXCR2 Membrane Protein

Interleukin-8 is a powerful neutrophil chemotactic factor, which can bind to CXCR2 with high affinity and transduce the signal through a G-protein-activated second messenger system. Moreover, chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA) is a protein with melanoma growth stimulating activity, which can also bind to CXCR2 involved in regulation the serum-dependent melanoma cell growth. CXCR2 has multiple biological functions. It is involved in the mediation of neutrophil migration to sites of inflammation, as well as the angiogenic effects of IL8 in intestinal microvascular endothelial cells. Recent studies also revealed that CXCR2 may be associated with proliferation, angiogenesis, invasion, migration, and resistance to drugs of the tumors. The overexpression of CXCR2 is correlated to poor overall and disease-free survival in metastatic colorectal cancer, laryngeal squamous cell carcinoma, lung cancer, pancreatic ductal carcinoma, clear-cell renal cell carcinoma and hepatocellular carcinoma, suggesting that CXCR2 overexpression may be a deteriorative indicator of cancer.

Schematic diagram illustrating the principal signaling pathways activated by IL-8 and their relevance to cell survival. Fig.1 Schematic diagram illustrating the principal signaling pathways activated by IL-8 and their relevance to cell survival. (Campbell, 2013)

Application of CXCR2 Membrane Protein in Literature

  1. Cao Q., et al. Therapeutic inhibition of CXC chemokine receptor 2 by SB225002 attenuates LPS-induced acute lung injury in mice. Archives of Medical Science. 2018, 14(3): 635-644. PubMed ID ID: 29765453

    The study implicates that SB225002, the inhibitor of CXCR2, is a potential novel treatment for LPS-induced acute lung injury. It could improve LPS-induced acute lung injury in mice via reducing neutrophil recruitment and vascular permeability.

  2. Qiao B., et al. The prognostic value of CXC chemokine receptor 2 (CXCR2) in cancers: a meta-analysis. Oncotarget. 2018, 9(19): 15068-15076. PubMed ID: 29599927

    The authors analyzed 2,461 patients with cancer from twelve studies using a meta-analysis. Results show that high CXCR2 levels are associated with poor overall survival (OS) and RFS in patients with laryngeal squamous cell carcinoma, lung cancer, pancreatic ductal carcinoma, clear-cell renal cell carcinoma and hepatocellular carcinoma, without in digestive tract cancer. Hence CXCR2 is a poor prognostic marker in patients with cancer except for digestive tract cancer.

  3. He J T., et al. CXCL1 and CXCR2 as potential markers for vital reactions in skin contusions. Forensic Science Medicine & Pathology. 2018, 14(2): 174-179. PubMed ID: 29607464

    The study finds that CXCL1 and CXCR2 protein levels are no difference between wounded and intact skin using western blot analysis. However, the CXCL1 and CXCR2 mRNA levels are higher in contused mouse and human skin compared with intact skin. These suggest that the CXCL1 and CXCR2 mRNA levels in contused skin can be used as potential markers for a vital reaction in skin contusions.

  4. Ignacio M C., et al. CXCR2 is a negative regulator of p21 in p53-dependent and independent manner via Akt-mediated Mdm2 in ovarian cancer. Oncotarget. 2018, 9(11): 9751-9765. PubMed ID: 29515768

    The study indicates that CXCR2 can promote ovarian cancer cell proliferation by suppressing p21 which is mediated via Akt-Mdm2 signaling in p53-dependent and independent manner.

  5. Wu S., et al. CXCR1/2 chemokine network regulates melanoma resistance to chemotherapies mediated by NF-kB. Current Molecular Medicine. 2017, 17(6): 436-449. PubMed ID: 29256349

    The study reveals that the higher levels of CXCL8 and CXCR2 are detected in melanoma cell line chronically exposed to chemotherapeutic drug dacarbazine compared with parent cells. These suggest that CXCL8 and CXCR2 levels can act as a signature of drug resistance.

CXCR2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CXCR2 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Campbell L M., et al. (2013). Rationale and Means to Target Pro-Inflammatory Interleukin-8 (CXCL8) Signaling in Cancer. Pharmaceuticals, 6(8): 929-59.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us