Close

CXCR6 Membrane Protein Introduction

Introduction of CXCR6

CXCR6 is a G protein-coupled receptor in the CXC chemokine receptor family, encoded by CXCR6 gene. It is one of seven CXC chemokine receptors (CXCR1-CXCR7) in mammals. The receptors can recognize CXC chemokine that possesses an E-L-R amino acid motif. CXCR6 is specifically expressed in multiple human tissues, such as lymph node, spleen. Recently, most studies focus on the role of CXCR6 in the pathological process of cancer.

Basic Information of CXCR6
Protein Name C-X-C chemokine receptor type 6
Gene Name CXCR6
Aliases BONZO, CD186, STRL33, TYMSTR
Organism Homo sapiens (Human)
UniProt ID O00574
Transmembrane Times 7
Length (aa) 342
Sequence MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH
KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL
TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC
GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF
LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

Function of CXCR6 Membrane Protein

CXCR6 is a receptor for CXCL16 and a coreceptor for HIV-1 and SIV. It is a prevalent chemokine expressed on macrophages, dendritic cells, monocytes, and B cell. CXCL6 is expressed on the surface of T cells, natural killer (NK) cells, and plasma cells. The interaction of CXCL16 and CXCR6 are involved in the inflammation response via mediating T-cell positioning and activation. It was identified that increased CXCR6 expression in circulating platelets and mononuclear leukocytes from patients with chronic obstructive pulmonary disease (COPD) may be a biomarker of systemic inflammation and influence cardiovascular disease (CVD) development. Besides, previous studies revealed that CXCR6 plays an important role in the mediation of pathological process of cancer. It was observed that CXCR6 and CXCL16 are overexpressed in multiple cancer tissues, such as prostate cancer, gastric cancer, and osteosarcoma compared to normal tissues and cell lines. In vivo, CXCR6/CXCL16 enhance the proliferation and invasion of prostate cancer. Moreover, CXCR6/CXCL16 may promote the inflammation-associated cancers through mediating pro-tumorigenic effects of inflammation.

CXCL16 and CXCR6 establish positive feedback loops contributing to the progression of inflammation-associated cancers. Fig. 1 CXCL16 and CXCR6 establish positive feedback loops contributing to the progression of inflammation-associated cancers. (Darashyahana, 2009)

Application of CXCR6 Membrane Protein in Literature

  1. Peng Y., et al. Activation of the CXCL16/CXCR6 axis by TNF-α contributes to ectopic endometrial stromal cells migration and invasion. Reproductive Sciences. 2018, (3): 193371911877679. PubMed ID: 29779473

    The study shows that CXCL16/CXCR6 axis may contribute to the progression of endometriosis and could be served as a potential target for diagnosis and treatment.

  2. Collado A., et al. Functional role of endothelial CXCL16/CXCR6-platelet-leukocyte axis in angiotensin II-associated metabolic disorders. Cardiovascular Research. 2018. PubMed ID: 29800106

    The study indicates that CXCR6 expression on platelet-bound monocytes and CD8+ lymphocytes may constitute a new membrane-associated biomarker for adverse cardiovascular events. Moreover, pharmacological modulation of this axis may positively affect the cardiovascular outcome in metabolic disorders linked to Ang-II.

  3. Marques P., et al. Cigarette smoke increases endothelial CXCL16-Leukocyte CXCR6 adhesion in vitro and in vivo. potential consequences in chronic obstructive pulmonary disease. Front Immunol. 2017, 8: 1766. PubMed ID: 29326688

    The study shows that increased numbers of CXCR6-expressing circulating platelets and mononuclear leukocytes from patients with chronic obstructive pulmonary disease (COPD) might be a marker of systemic inflammation with potential consequences in cardiovascular disease (CVD) development. Accordingly, CXCL16/CXCR6 axis blockade might constitute a new therapeutic approach for decreasing the risk of CVD in COPD patients.

  4. Jin J J., et al. CXCR6 predicts poor prognosis in gastric cancer and promotes tumor metastasis through epithelial-mesenchymal transition. Oncology Reports. 2017, 37(6): 3279-3286. PubMed ID: 28440473

    The authors identify that CXCR6 can act as an independent prognostic factor for poor survival in gastric cancer via in vitro and in vivo study. And CXCR6 may promote gastric cancer metastasis through epithelial-mesenchymal transition.

  5. Ke C., et al. Association between CXCL16/CXCR6 expression and the clinicopathological features of patients with non-small cell lung cancer. Oncology Letters. 2017, 13(6): 4661-4668. PubMed ID: 28599467

    The study indicates that the expression of t-CXCL16 and t-CXCR6 is positively correlated with the TNM stage and lymph node metastasis in patients with non-small cell lung cancer (NSCLC). Additionally, there was a significant increase in s-CXCL16 levels in patients with NSCLC, suggesting that CXCL16 could be used as a supplementary biomarker for the early detection of NSCLC.

CXCR6 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CXCR6 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Darashyahana M, et al. (2009). The chemokine CXCL16 and its receptor, CXCR6, as markers and promoters of inflammation-associated cancers. Plos One. 4(8), e6695.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us