Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of DRD1
DRD1, a subtype of the dopamine receptor, is the most primary dopamine receptor present in the central nervous system. The D1 receptor family is composed of D1 and D5 subtype. DRD1 is a member of G-protein coupled receptor and Gs/a coupled that indirectly activates cyclic AMP-dependent protein kinase, stimulating the neuron. Due to a high degree of structural homology, both DRD1 and another dopamine receptor D5 bind similar drugs.
| Basic Information of DRD1 | |
| Protein Name | D(1A) dopamine receptor |
| Gene Name | DRD1 |
| Aliases | DADR, DRD1A |
| Organism | Homo sapiens (Human) |
| UniProt ID | P21728 |
| Transmembrane Times | 7 |
| Length (aa) | 446 |
| Sequence |
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT |
Function of DRD1 Membrane Protein
DRD1, an intermediate in the biosynthesis of noradrenaline and adrenaline, mediates the effect of the neurotransmitter dopamine. It is implicated in the control of motor activity and cognitive memory. Downregulation of DRD1 leads to severe impairments in working memory and to locomotor hyperactivity, which are observed in diseases such as schizophrenia, Parkinson's disease, affective disorders, and attention deficit hyperactivity disorder. DRD1 functions as regulation of neuronal growth and development, as well as the mediation of some behavioral responses, and modulation dopamine receptor D2-mediated events. DRD1 is involved in many neurological processes, including motivation, pleasure, cognition as well as modulation of neuroendocrine signaling. Dopaminergic signaling plays an important role in the nervous system and dopamine receptors are expected to be common neurologic drug targets. In addition, they might provide a novel therapeutic target for breast cancer and bone metastasis.
Fig.1 Structure of DRD1 membrane protein.
Application of DRD1 Membrane Protein in Literature
In vivo study has suggested that pardoprunox, a partial D2/D3 receptor and 5-HT1A receptor agonist, represents a promising approach for the treatment of Parkinson's disease.
This article reveals that dopaminergic signaling might provide a novel therapeutic target for breast cancer and bone metastasis.
This article suggests that the dopamine D(1A) receptor is related to the expression of vacuous chewing movements in a rodent model of tardive dyskinesia and may contribute to the pathogenesis of the human disorder.
This article shows that D(1), but not 5-HT(1A) receptor, play a role in mediating the cognitive effects of asenapine in this rodent model.
This article indicates that D-1 dopamine receptors are coupled to both Gs alpha and G(o) alpha but not to Gq alpha.
DRD1 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-DRD1 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
