Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of DRD4
DRD4, encoded by the DRD4 gene, is a dopamine D2-like G protein-coupled receptor. A recent report has shown that the structure of DRD4 was in complex with the antipsychotic drug nemonapride. Similar to other dopamine receptor subtypes, the D4 receptor is activated by the neurotransmitter dopamine. Many research have shown that DRD4 was related to many neurological and psychiatric conditions, including schizophrenia and bipolar disorder, attention deficit hyperactivity disorder (ADHD), addictive behaviors, Parkinson's disease, and eating disorders.
| Basic Information of DRD4 | |
| Protein Name | D(4) dopamine receptor |
| Gene Name | DRD4 |
| Aliases | NA |
| Organism | Homo sapiens (Human) |
| UniProt ID | P21917 |
| Transmembrane Times | 7 |
| Length (aa) | 467 |
| Sequence |
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC |
Function of DRD4 Membrane Protein
Dopamine receptors control neural signals that modulate behavior. The D4 receptor is considered to be D2-like in which the activated receptor inhibits the enzyme adenylate cyclase, thereby reducing the intracellular concentration of the second messenger cyclic AMP. Associations were found with ADHD, substance dependences, several specific personality traits, and reaction to stress. These findings have implications for pharmacogenetics. DRD4 has an influence on the postsynaptic action of dopamine and is implicated in many neurological processes, exhibits polymorphism and is one of the most studied genes in connection with psychiatric disorders. As a target for drugs, DRD4 has been applied, which play a role in treating schizophrenia and Parkinson disease.
Fig.1 Structure of DRD4 membrane protein.
Application of DRD4 Membrane Protein in Literature
This article reports that the selective overexpression of DRD4 at the neuronal level reduced 3-NP-induced neurodegeneration, which suggests an important function of the neuronal DRD4 in the modulation of neurodegeneration.
This article reveals that provide insight into the regulatory role of the D(4) receptor on AT(1a) receptor expression and function in VSMCs and suggest that targeting the action of the D(4) receptor may represent an effective therapeutic approach for the treatment of cardiovascular diseases.
This article shows that the dopamine D(4) receptor is an interesting receptor since it has a polymorphic region in its third intracellular loop, resulting in receptor isoforms of varying length and amino acid composition.
This article reviews the principle published associations of DRD4 variants with psychiatric disorders.
DRD4 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-DRD4 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
