Biotinyl-LL-37, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ292)
Product Quick View
Biotinyl-LL-37 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
| Overview | |
|---|---|
| Synonyms | Biotinyl-LL-37; Biotin-LL-37; Biotin-labeled LL-37 |
| Source | Synthetic/Derived |
| Sequence | {Biotinyl-Leu}-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys- Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | {Biotinyl-Leu}-LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Biotinylated |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Andropin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ259)
- LY121019, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ485)
- Urechistachykinin II, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ638)
- CyLip-10, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ176)
- D-K6L9, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ388)
- Dermaseptin-B9, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ377)
- Lunasin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ46)
- LANA peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ460)
Online Inquiry