Citrullinated LL-37 (1cit), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ341)
Product Quick View
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B.
| Overview | |
|---|---|
| Synonyms | Citrullinated LL-37 1cit; LL-37 1-citrullinated |
| Source | Synthetic/Derived |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-{Cit}-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Va l-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | LLGDFF-{Cit}-KSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Anti-inflammatory |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Gageotetrin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ408)
- Cm-CATH2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ346)
- Hs02, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ440)
- Gramicidin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ423)
- Decoralin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ370)
- Aurein 3.1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ274)
- Nv-CATH, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ537)
- Bombinin-BO1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ301)
Online Inquiry