Dermaseptin-B9, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ377)
Product Quick View
Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the Phyllomedusinae subfamily.
| Overview | |
|---|---|
| Synonyms | Dermaseptin-B9; Dermaseptin B9; DS-B9 |
| Source | Amphibian |
| Sequence | Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-L eu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser |
| Sequence Shortening | ALWKTIIKGAGKMIGSLAKNLLGSQAQPES |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Protozoa; Cancer; Amphibian |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Maximin 3, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ499)
- Cathelicidin-PY, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ42)
- Polistes mastoparan, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ213)
- SP-B peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ605)
- RT2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ596)
- Crotamine, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ361)
- RA-VII, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ582)
- Peptide 5f, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ558)
Online Inquiry