Human α-defensin 1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ54)
Product Quick View
Defensin HNP-1 human is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human has antileishmanial activity. Defensin HNP-1 human is involved in endothelial cell dysfunction during the early development of atherosclerosis.
| Overview | |
|---|---|
| Synonyms | HNP-1; Defensin HNP-1 human; Human neutrophil peptide 1; DEFA1 |
| Source | Human |
| CAS | 148093-65-6 |
| Molecular Formula | C150H222N44O38S6 |
| Molecular Weight | 3442.03 |
| Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gl n-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys 29) |
| Sequence Shortening | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9- Cys29) |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Human |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- PMAP-23, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ235)
- Ceratotoxin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ184)
- Garvicin KS (GakA), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ412)
- Bombinin H1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ293)
- Maximin H39, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ519)
- Bombinin-like peptide 2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ302)
- RT2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ596)
- Maculosin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ106)
Online Inquiry