Human β-defensin 2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ234)
Product Quick View
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus. Human β-defensin-2 can be used for the study of colitis.
| Overview | |
|---|---|
| Synonyms | HβD-2; Human β-defensin-2; hBD-2; DEFB4; Beta-defensin 2 |
| Source | Human |
| CAS | 372146-20-8 |
| Molecular Formula | C188H305N55O50S6 |
| Molecular Weight | 4328.20 |
| Sequence | Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro- Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Dis ulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
| Sequence Shortening | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; C ys15-Cys30; Cys20-Cys38) |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Human |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Cecropin A TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ39)
- Human α-defensin 6, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ444)
- Jelleine-I, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ230)
- EK1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ394)
- Palicourein, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ547)
- Argadin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ88)
- Cecropin D, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ333)
- Amphomycin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ156)
Online Inquiry