Palicourein, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ547)

Product Quick View

Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM.

Overview
SynonymsPalicourein; Palicourein peptide
SourceNot specified
SequenceCyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-A la-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
Sequence ShorteningCyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4, Cys2-Cys5,Cys3-Cys6)
ActivityGram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Immunomodulation
Physical StatePowder
Purity>98%
StorageThe power can be stored at 4°C for 2 years or at -20°C for 3 years.

For Research Use Only.

Related products
Online Inquiry
Name:
Phone:
*E-mail Address:
*Service & Products Interested:
Project Description:

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.