Rabbit neutrophil peptide 3b, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ581)
Product Quick View
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils.
| Overview | |
|---|---|
| Synonyms | Rabbit neutrophil peptide 3b; NP-3b |
| Source | Synthetic |
| Sequence | Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met- Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge: C3-32;C5-C21;C11-C31) |
| Sequence Shortening | GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR (Disulfide bridge:C3-32;C5-C21;C11-C31) |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Rabbit |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- PMAP-23, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ235)
- Lunasin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ46)
- Reltecimod TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ64)
- EP2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ396)
- LL-37 scrambled peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ479)
- Cecropin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ30)
- Maximin 31, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ500)
- AcrAP2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ248)
Online Inquiry