TLN-58, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ631)
Product Quick View
TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells.
| Overview | |
|---|---|
| Synonyms | TLN-58; TLN58 |
| Source | Synthetic |
| Sequence | Thr-Leu-Asn-Gln-Ala-Arg-Gly-Ser-Phe-Asp-Ile-Ser-Cys-Asp-Lys-Asp-Asn-Lys-Arg-Phe-Al a-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-V al-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | TLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Temporin L, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ194)
- L-K6L9, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ470)
- Lactoferricin H, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ459)
- Human α-defensin 6, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ444)
- Suicin 65, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ608)
- Magainin 2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ112)
- JB-95 acetate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ227)
- ToAP2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ632)
Online Inquiry