Introduction of FXYD2
FXYD2 belongs to the FXYD family, the members of which share a common signature sequences encompassing the transmembrane domain and adjacent regions. FXYD2 is encoded by the FXYD2 gene which is located at 11q23. And the gene mutations can cause hypomagnesemia 2 (HOMG2). Moreover, FXYD2 is a single-pass type III membrane protein, with its N-terminus on the extracellular side of the membrane and no signal sequence.
| Basic Information of FXYD2 | |
| Protein Name | Sodium/potassium-transporting ATPase subunit gamma |
| Gene Name | FXYD2 |
| Aliases | FXYD domain-containing ion transport regulator 2, Sodium pump gamma chain, Na (+)/K (+) ATPase subunit gamma |
| Organism | Homo sapiens (Human) |
| UniProt ID | P54710 |
| Transmembrane Times | Single-pass membrane |
| Length (aa) | 66 |
| Sequence | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Function of FXYD2 Membrane Protein
FXYD2 mainly acts as a γ subunit of Na+, K+-ATPase (NKA) which is required to generate the resting membrane potential in neurons. Association of FXYD2 with α1NKA can negatively regulate the NKA activity by depolarizing the membrane potential of nociceptive neurons. Moreover, the regulation is tissue- and isoform-specific. FXYD2 is found to be expressed in the distal convoluted tubule of kidney and can also be found on basolateral membranes of nephron epithelial cells. FXYD2 plays a role in ATP hydrolysis coupled transmembrane transport, potassium ion import across plasma membrane, regulation of cell growth and proliferation and many other biological processes. Accordingly, the increased FXYD2 activity may be a fundamental mechanism underlying the persistent hypersensitivity to pain induced by inflammation. Beyond that, FXYD1 is highly and specifically expressed in clinical ovarian clear cell carcinoma (OCCC) tissues. It is functionally upregulated in OCCC and likely to be a promising prognostic biomarker and therapeutic target of cardiac glycosides in OCCC. What’ s more, FXYD2 regulates Aδ- and C-fiber mechanosensitivity and is required for the maintenance of neuropathic pain.
Fig.1 Structure of FXYD2b determined in micelles (Gong, 2014).
Application of FXYD2 Membrane Protein in Literature
Authors find that FXYDD2 is highly and specifically expressed in clinical OCCC tissues. They reveal that FXYD2 is functionally upregulated in Ovarian clear cell carcinoma (OCCC) and may serve as a promising prognostic biomarker and therapeutic target of cardiac glycosides in OCCC.
This review discuses about functional properties of FXYD2, and unexpected and noteworthy phenotypes discovered in a FXYD2−∕− mouse. FXYD2 modulates both ion transport and signaling.
This article suggests that FXYD2 is specifically required for setting the mechanosensitivity of Aδ-fiber sub-populations of C-fiber nociceptors and low-threshold mechanoreceptors. FXYD2 may function as a potentially promising therapeutic target for peripheral neuropathic pain management.
This article reveals that FXYD2 is necessary for maintaining the mechanical allodynia induced by peripheral inflammation in nociceptive neurons. The increased FXYD2 activity may be a fundamental mechanism underlying the persistent hypersensitivity to pain induced by inflammation.
This article describes a phage display-derived peptide (P88) that is highly specific to (FXYD2) γa expressed by human beta cells and is proposed to be a molecular vector for the development of functionalized imaging probes.
FXYD2 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-FXYD2 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.