Close

FXYD7 Membrane Protein Introduction

Introduction of FXYD7

FXYD domain-containing ion transport regulator 7 (FXYD7) is a protein encoded by the human FXYD7 gene. It belongs to the FXYD family which consists of seven single-span transmembrane proteins termed after the invariant extracellular motif Phe-XXX-Tyr-Asp. Studies have shown that FXYD7 could interact with the Na+/K+ ATPase and modulate its kinetic properties.

Basic Information of FXYD7
Protein Name FXYD domain-containing ion transport regulator 7
Gene Name FXYD7
Aliases N/A
Organism Homo sapiens (Human)
UniProt ID P58549
Transmembrane Times 1
Length (aa) 80
Sequence MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV

Function of FXYD7 Membrane Protein

FXYD7 belongs to the FXYD family which contains 7 members sharing a signature sequence consisting of the FXYD motif and 3 other conserved amino acid residues. The FXYD protein family has recently been defined as a result of the search for homologues of the Na, K-ATPase gamma subunit, CHIF, and phospholemman in EST and gene data banks. As a member of the FXYD family, FXYD7 undergoes O-glycosylation on three extracellular N-terminal threonine residues, which indicate that it may play a role in protein stability. Studies have shown that FXYD7 is exclusively expressed in brain, both in neurons and glial cells, and may act as a critical role in the regulation of brain function. What’s more, it has been reported that FXYD7 is a novel, tissue- and isoform-specific Na, K-ATPase regulator which could play an important role in neuronal excitability.

FXYD7 Membrane Protein IntroductionFig.1 Schematic representation of Na+, K+-ATPase structure. (de Lores Arnaiz, 2014)

Application FXYD7 of Membrane Protein in Literature

  1. Crambert G., et al. FXYD7: mapping of functional sites involved in ER export, association with and regulation of Na, K-ATPase. Journal of Biological Chemistry. 2004, 279(29):30888-95. PubMed ID: 15133029

    This article provides new information on structural determinants of general importance for FXYD protein action. It indicates that FXYD7 has a particular regulatory function in the brain.

  2. Li C., et al. Role of the transmembrane domain of fxyd7 in functional interactions with Na, K-ATPase. Journal of Biological Chemistry. 2005, 280(52):42738-43. PubMed ID: 16269407

    This article aims to investigate the contribution of amino acids in the transmembrane (TM) domain of FXYD7 to the interaction with Na, K-ATPase. It highlights the important structural and functional role of the TM domain of FXYD7 and delineates the determinants that mediate the complex interactions of FXYD7 with Na, K-ATPase.

  3. Crambert G., et al. FXYD7, the first brain-and isoform-specific regulator of Na, K-ATPase. Annals of the New York Academy of Sciences. 2003, 986(1):444-8. PubMed ID: 12763863

    This study investigates the biosynthesis, membrane topology, nature, and role of the processing of FXYD7.

  4. Béguin P., et al. FXYD7 is a brain-specific regulator of Na, K-ATPase α1-β isozymes. The EMBO Journal. 2002, 21(13):3264-73. PubMed ID: 12093728

    This article aims to investigate the tissue distribution and the structural and functional properties of FXYD7. It suggests that FXYD7 is a novel, tissue- and isoform-specific Na, K-ATPase regulator which could play an important role in neuronal excitability.

FXYD7 Preparation Options

During the past years, we have successfully established a cutting-edge MemDX™ membrane protein production platform which enables us to provide high-quality membrane protein products for worldwide customers. Besides, aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-FXYD7 antibody development services.


Based on a wealth of experience and professional scientists, Creative Biolabs is committed to delivering multiple membrane protein preparation services in the most high-quality and cost-effective way. Except for FXYD7 membrane protein preparation services, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more detailed information, please feel free to contact us for more information.

Reference

  1. de Lores Arnaiz G R and Ordieres M G. (2014). Brain Na+, K+-ATPase activity in aging and disease. International journal of biomedical science. 10(2), 85-102.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us