Close

FZD1 Membrane Protein Introduction

Introduction of FZD1

FZD1, also known as frizzled class receptor 1, frizzled family receptor 1, frizzled (Drosophila) homolog 1, Fz-1, hFz1 or FzE1, is a transmembrane protein that consists of 647 amino acids and has a molecular mass of about 71 kDa. In humans, it is encoded by the FZD1 gene located on the chromosome 7q21.13. The FZD1 protein contains a signal peptide, seven transmembrane domains, a cysteine-rich domain (CRD) in the N-terminal extracellular region, and a C-terminal PDZ domain-binding motif. It is a member of the G-protein coupled receptor Fz/Smo family and employed as a receptor in the Wnt pathway and other signaling pathways. FZD1 is expressed on the heart, lung, kidney, pancreas, prostate, ovary, placenta in adults, as well as in the fetal lung and kidney. Northern blot analysis displays that its transcript is a 4.5-kb mRNA found in varieties of tissues.

Basic Information of FZD1
Protein Name Frizzled-1
Gene Name FZD1
Aliases Frizzled Class Receptor 1, Frizzled 1, Seven Transmembrane Spanning Receptor, Frizzled, Drosophila, Homolog Of, 1, Frizzled Family Receptor 1, Wnt Receptor, Fz-1, FzE1, HFz1, Frizzled (Drosophila) Homolog 1, Frizzled Homolog 1
Organism Homo sapiens (Human)
UniProt ID Q9UP38
Transmembrane Times 7
Length (aa) 647
Sequence MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLAR
QLLLLLWLLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGER
GISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKV
QCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDT
LKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGA
GASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSR
TWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFL
LEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLN
NVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVR
IGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGA
PPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGE
TTV

Function of FZD1 Membrane Protein

FZD1 functions as a receptor for Wnt proteins, secreted cell signaling proteins that involved in development and homeostasis. And it binds Wnt signaling proteins relying on its extracellular CRD structure. Most of the frizzled receptors are coupled to the canonical β-catenin signaling pathway, which brings out an activation of disheveled proteins, suppression of GSK-3 kinase, nuclear accumulation of β-catenin, along with activation of Wnt target genes. Frizzled proteins and such genes coding for them have been identified in a number of animals, ranging from sponges to humans. And these type proteins play critical roles in governing cell polarity, embryonic development, neural synapses formation, cell proliferation, and lots of other processes in developing and adult individuals. Additionally, there is an important paralog of FZD1 gene is FZD7 and they share 74% protein sequence identity with each other.

Model of Wnt5a/Fzd5 and Wnt3a/Fzd1 as modulators of the inflammatory response of macrophages to microbial stimuli. Fig.1 Model of Wnt5a/Fzd5 and Wnt3a/Fzd1 as modulators of the inflammatory response of macrophages to microbial stimuli. (Schaale, 2011)

Application of FZD1 Membrane Protein in Literature

  1. Wang Y.H., et al. Knockdown of the Wnt receptor Frizzled-1 (FZD1) reduces MDR1/P-glycoprotein expression in multidrug resistant leukemic cells and inhibits leukemic cell proliferation. Leuk Res. 2018, 67: 99-108. PubMed ID: 29482174

    The FZD1 receptor of Wnt is implicated in multidrug resistance (MDR) in several solid tumors, but it rarely reported in acute myeloid leukemia (AML). Authors concluded after assays that the activated FZD1 detected in leukemic cells may be confer acquired drug resistance, while FZD1 silencing is likely more effective in reversing MDR.

  2. Han S., et al. Substratum stiffness tunes proliferation downstream of Wnt3a in part by regulating integrin-linked kinase and frizzled-1. J Cell Sci. 2018,131(8). PubMed ID: 29588395

    This review showed that integrin-linked kinase (ILK) can regulate the expression of frizzled-1 (Fzd1), a Wnt receptor, implying that the presence of a positive feedback between ILK, Fzd1, and Wnt3a. The results may indicate that tissue mechanics modulates the cellular response to Wnt signaling under physiological and pathological microenvironmental circumstances.

  3. Fan J., et al.Recombinant frizzled1 protein attenuated cardiac hypertrophy after myocardial infarction via the canonical Wnt signaling pathwayOncotarget. 2017, 9(3): 3069-3080. PubMed ID: 29423029

    Activation of classical Wnt signaling induced by myocardial infarction (MI), is inhibited in the left ventricles of the MI-mice treated by recombinant FZD1 protein (RFP). Authors concluded that the immunization of RFP can attenuate cardiac hypertrophy and improved cardiac function in the MI mice by blocking the Wnt pathway.

  4. Yang L., et al. Overexpression of FZD1 and CAIX are Associated with Invasion, Metastasis, and Poor-Prognosis of the Pancreatic Ductal Adenocarcinoma. PatholOncol Res. 2017. PubMed ID: 28921449

    About 80% of patient cases with pancreatic ductal adenocarcinoma (PDAC) have metastatic symptoms with poor prognosis. This article showed that positively expressed FZD1 and CAIX are poor prognostic factors in patients with PDAC. These two may be significant biological markers for PDAC carcinogenesis, invasion, metastasis, and prognosis.

  5. Su W., et al. MiR-135b reverses chemoresistance of non-small cell lung cancer cells by down regulation of FZD1. Biomed Pharmacother. 2016, 84: 123-129. PubMed ID: 27643554

    The chemoresistance of non-small cell lung cancer (NSCLC) frequently limits the clinical efficacy of therapeutic methods. And few studies have reported the regulation of miR-135b and Frizzled-1 (FZD1) in NSCLC chemoresistance. This review indicated that miR-135b amplifications suppress NSCLC chemoresistance through directly mediating FZD1 downregulations.

FZD1 Preparation Options

To harvest the stable and native target protein, we present strong reconstitutions and various active formats for membrane proteins. Our versatile and robust Magic™ membrane protein production platform shows many flexible options, from which you can eventually select an optimal match applied in your projects. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CHRM1 antibody development services.


Creative Biolabs as a famous research institute and a professional custom service provider in membrane protein markets has obtained good recognition among global customers. We have succeeded to generate quantities of functional membrane proteins to satisfy customers’ requirements and devote to tailoring one-stop, custom-oriented services for membrane proteins to be studied. Please feel free to contact us for more information.

Reference

  1. Schaale K, et al. (2011). Wnt signaling in macrophages: augmenting and inhibiting mycobacteria-induced inflammatory responses. Eur J Cell Biol. 90(6-7), 553-9.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us