Close

FZD10 Membrane Protein Introduction

Introduction of FZD10

FZD10, also known as frizzled class receptor 10, frizzled family receptor 10, frizzled (Drosophila) homolog 10, Fz-10, hFz10, FzE7, CD350 antigen or CD350, is a 65k Da cell surface receptor that belongs to the frizzled gene family and in humans, encoded by the chromosome 12q24.33. This protein consists of 581 amino acids with a 7-transmembrane domain, an N-terminal cysteine-rich domain (CRD) and a C-terminal Ser/Thr-Xxx-Val motif. A great deal of FZD10 mRNA, about 4.0 kb in size, is detected in the placenta and fetal kidney, followed by fetal brain and lung. When it comes to adults, the mRNA level of this gene is abundant in the cerebellum. There is report indicated that FZD10 is highly expressed in cervical cancer cell lines of HeLa S3, and moderately in colon cancer cells, SW480.

Basic Information of FZD10
Protein Name Frizzled-10
Gene Name FZD10
Aliases Frizzled Class Receptor 10, Frizzled 10, Seven Transmembrane Spanning Receptor, Frizzled Family Receptor 10, FZ-10, HFz10, FzE7, Frizzled (Drosophila) Homolog 10, Frizzled Homolog 10, CD350 Antigen, CD350, Fz10
Organism Homo sapiens (Human)
UniProt ID Q9ULW2
Transmembrane Times 7
Length (aa) 581
Sequence MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV

Function of FZD10 Membrane Protein

FZD10 is a receptor for the Wingless type MMTV integration site family of signaling proteins. It is a member of the frizzled gene family, members of which code for 7-transmembrane domain proteins that functions as receptors for the Wingless type MMTV integration site family of signaling proteins. Most of the frizzled receptors can be coupled to the β-catenin classical signaling pathway. By assay analysis, the expression of this intronless gene is strikingly up-regulated in two types of primary colon cancer. Several diseases are studied to be associated with FZD10 including deafness and autosomal dominant. And its related pathways are gastric cancer and PI3K/Akt signaling pathway. FZD10 shares 65.7% amino-acid identity with frizzled-9 (FZD9) and they two constitute a subfamily among the frizzled genes. In addition, current findings revealed that the overexpression of FZD10 receptor for molecules in the Wnt pathway can be considered as a potential contributor to synovial sarcomas.

FZD10 Membrane Protein Introduction

Application of FZD10 Membrane Protein in Literature

  1. Scavo M.P., et al. Frizzled-10 and cancer progression: Is it a new prognostic marker? Oncotarget. 2017, 9(1): 824-830. PubMed ID: 29416658

    This article demonstrated the important role of FZD-10 in cancer progression, particularly in the later phages of tumor. The FZD-10 expression in nucleus or its absence provides a new tool regarding tumor staging for pathologists. For target therapy of colon cancer, at least, the high level of FZD-10 in the later cancer progression and the absence in healthy tissue present a promising sight.

  2. Hot B., et al. FZD10-Gα13 signaling axis points to a role of FZD10 in CNS angiogenesis. Cell Signal. 2017, 32: 93-103. PubMed ID: 28126591

    In this finding, authors observed a relevance between FZD-10 expression and cancer evolution, together with the localization of this protein during carcinogenesis. In the colon, an increase of cytoplasmic FZD-10 presence from hyperplastic mucosa to metastatic tissues has been discovered, while the expression in the nucleus decreases greatly in T3, T4 staging tumors and in metastases.

  3. Gong C., et al. BRMS1L suppresses breast cancer metastasis by inducing epigenetic silence of FZD10. Nat Commun. 2014, 5: 5406. PubMed ID: 25406648

    BRMS1L (Breast cancer metastasis suppressor 1 like), functionally, inhibits breast cancer cell migration and invasion through suppressing epithelial-mesenchymal transition (EMT). All effects are mediated by epigenetic silencing of FZD10 by the HDAC1 (Sin3A-histone deacetylase 1) recruitment and histone H3K9 deacetylation at the promoter.

  4. Galli L.M., et al. Frizzled10 mediates WNT1 and WNT3A signaling in the dorsal spinal cord of the developing chick embryo. Dev Dyn. 2014, 243(6): 833-843. PubMed ID: 19134005

    This report showed that the spatiotemporal expression patterns among FZD10 and WNT1/WNT3A are highly associated. By a series of assays, scientists uncovered that FZD10 is necessary for the proliferation in the spinal cord. Furthermore, there is an interaction between FZD10 and WNT1&WNT3A proteins. Conclusively, FZD10 was identified as a receptor for WNT1 and WNT3A signaling in the developing chick spinal cord.

  5. Nagayama S., et al. Inverse correlation of the up-regulation of FZD10 expression and the activation of beta-catenin in synchronous colorectal tumors. Cancer Sci. 2009, 100(3): 405-412. PubMed ID: 29464029

    This paper displayed results that compared to FZD10-immunonegative cancer cells, immunopositive cells is significantly less nuclear accumulation of beta-catenin, and there is a strong inverse relevance between nuclear immunostaining scores for the beta-catenin level and expression pattern of FZD10, which suggests FZD10 has a distinct role in canonical Wnt signal transduction.

FZD10 Preparation Options

To produce the stable, soluble, and functional target protein, Creative Biolabs exhibits robust reconstitutions and various active formats for membrane proteins. Our versatile and powerful Magic™ membrane protein production platform offers many flexible options and clients can select a better match applied in their specialized research. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD10 antibody development services.


Creative Biolabs as a well-known custom service provider and research institute in membrane protein markets has gained a good reputation from global scientists and customers for outstanding accomplished challenging items. Now, we are happy to offer mature and advanced systems to popularize related services regarding membrane protein preparations in requirements by multiple technologies. Please feel free to contact us for more information.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us